(data stored in ACNUC7421 zone)

EMBL: CP000675.PE18

CP000675.PE18        Location/Qualifiers
FT   CDS_pept        21604..22509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54018"
FT                   /protein_id="ABQ54018.1"
FT                   /translation="MRRWLGVQAFSYVELRSIQISTVFAFTIFVQEWLRYPRAGWTGFA
FT                   VMMIYAGFDNGTTIFRTYHRFLGVLLGLFTGYLLWFVGHLDYRTLILIMPLMVFFAFFL
FT                   VGRAYSVPTVFTVNVSVLGSGYFSTEDTLPVTYFIIDYTLCTLIAFTIILGFEYFWFRH
FT                   YGLMQRFIKSTQAEVIDDLYRLVRLLNQGKIKKTEWFQACIKLTDSLFEVNKLITNSQF
FT                   LISSEHAVGDEFNQFVELANRIFIGLKALYMAYYTKHYHTFDYYQLFQQVQKDLVHLKD
FT                   FVAGEQTIDLSEGVKHATSG"
     atgcgccgat ggttaggagt acaggcattt tcttatgttg agctgcgctc tattcagatc        60
     agtacggtct ttgcgtttac tatttttgtc caggaatggt tgcgttatcc gcgggccggg       120
     tggacgggct ttgctgtcat gatgatttat gccggttttg ataatggaac aactatattc       180
     aggacgtatc atcggttttt aggagtgctt ttaggcctat tcaccggata tctattatgg       240
     tttgtaggtc atctggatta tcgaacgtta attctgatta tgcctttaat ggtttttttc       300
     gcgtttttcc tggtaggaag agcatacagt gttcccactg tatttacggt caatgtgtca       360
     gtacttggtt ctggttactt tagtacggaa gatacgctcc cagtcaccta ttttattatc       420
     gattataccc tttgcacgtt gatcgccttt actattattc taggttttga atatttttgg       480
     tttaggcatt acggactgat gcagcgattt atcaaaagta ctcaggctga agtgattgat       540
     gatctttaca ggctggttcg tttgttaaat cagggtaaaa taaaaaaaac agaatggttc       600
     caggcttgta tcaagttgac tgacagtttg tttgaggtca ataagctcat aacaaattcc       660
     cagtttttaa tcagttcaga acatgctgtc ggggatgaat ttaatcagtt tgtggaattg       720
     gctaatcgta ttttcattgg cctgaaagcc ttatatatgg cttattatac gaaacattat       780
     catacgtttg attattatca actatttcaa caggttcaaa aagatttggt gcacttaaaa       840
     gattttgttg caggggagca aacaattgat cttagtgagg gagtaaagca tgctacgtcc       900
     ggttaa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page