(data stored in ACNUC7421 zone)

EMBL: CP000675.PE184

CP000675.PE184       Location/Qualifiers
FT   CDS_pept        complement(200533..200904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54184"
FT                   /protein_id="ABQ54184.1"
FT                   /translation="MKVLLSIKPEYAEKILNGKKKFEFRKVIPKAGAKTVLLYATKPIG
FT                   KVVGEFEVDSFLSEKPNKLWDLTSSFSGISECFFYKYFEGYETAHAFKISKVYRYKEPV
FT                   DIKTVLASGVIPQSFCYLK"
     atgaaagtct tattgtccat taagccagaa tatgcagaaa aaatattaaa cggaaaaaag        60
     aaatttgaat ttcgtaaggt tatacctaaa gcaggagcca aaacggttct tctttacgcg       120
     accaaaccaa taggcaaagt tgtcggtgaa tttgaagttg attcattttt atcagaaaaa       180
     ccaaataaac tatgggatct aacttctagt ttttcaggga tatctgagtg ctttttttat       240
     aaatattttg aaggctatga aactgcacat gctttcaaga ttagcaaagt atacagatat       300
     aaagagccag tagatattaa aactgtttta gctagtggag tcattcctca atccttttgt       360
     tatttaaaat ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page