(data stored in ACNUC7421 zone)

EMBL: CP000675.PE185

CP000675.PE185       Location/Qualifiers
FT   CDS_pept        complement(200882..201940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54185"
FT                   /protein_id="ABQ54185.1"
FT                   /translation="METVNLEKVQFKTIDLSDPFFDSLKSDYLEFPNWFKKKSEEFAYI
FT                   FRNDSGLIDGFLYLKQESEAIPDVIPPLPPKQRIKVGTMKINAHGTKLGERFLKKIFDH
FT                   AIFESVSEIYVTVFPHHTNLVTLFERYGFNCTAEKITQNGKELVLIKKMFGPYTDIISN
FT                   YPLINIAGQKIYLLSLYPKWHTRLLPDSILKGENSNVVQDISYTNSIHKVYLASMREMD
FT                   NLKKGDVLVIYRTNDNKGPARYRSVVTSICVLEEYKSIYEFKKLEQFLAYCDPYSVFEK
FT                   SELEDFWKNKKFAHIIRFTYNLALKKRIIRDDLINQIGLNEHDYWGFMPLTNEQFLEII
FT                   KRGEIDESLIVH"
     atggaaaccg tgaatttaga aaaggtacaa ttcaaaacga tagatttatc tgaccctttt        60
     tttgattctt tgaagtctga ttacttggaa tttccaaatt ggtttaaaaa aaaatcagaa       120
     gaatttgctt atatatttag aaatgatagc ggtcttattg atggattttt gtacttaaaa       180
     caagaaagtg aagctatccc tgatgttatt cccccgttgc ctccaaagca gaggattaaa       240
     gttggaacaa tgaaaataaa tgctcatgga acaaaattgg gtgagaggtt cttaaaaaaa       300
     atttttgacc acgctatctt tgaaagtgta agtgagattt atgtcaccgt gtttccgcat       360
     catactaatt tagtgacttt attcgaacgt tatggtttta attgcacagc tgaaaaaatc       420
     acacaaaatg gcaaggagct agttttaata aaaaaaatgt ttgggccata cacagatata       480
     atctcaaatt atcccctcat taatattgca ggtcagaaaa tatatttgct ttctttgtat       540
     cccaaatggc atacacgctt gttaccagat tcaatcttaa agggtgaaaa tagtaatgta       600
     gtacaggata tatcatacac taatagcatt cataaagttt atttagcctc aatgagagag       660
     atggataatt taaaaaaagg agatgtgctg gttatttatc gtacaaatga taataaagga       720
     cccgctcgat atcgatctgt agtaacttct atttgtgtat tagaagaata taaatcaatt       780
     tacgaattta aaaagctaga gcagtttcta gcttattgtg atccatacag tgttttcgag       840
     aaatctgaac tggaagattt ttggaaaaat aaaaaatttg ctcatatcat taggtttacc       900
     tataacctgg ctctaaaaaa gagaataatt cgtgacgatc tgattaacca gattggatta       960
     aatgagcatg attattgggg atttatgcca ctaactaacg aacaattttt agaaatcatc      1020
     aaaaggggcg aaatagatga aagtcttatt gtccattaa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page