(data stored in ACNUC7421 zone)

EMBL: CP000675.PE188

CP000675.PE188       Location/Qualifiers
FT   CDS_pept        207613..208338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54188"
FT                   /protein_id="ABQ54188.1"
FT                   /translation="MAKIHITMQGKGGVGKSFVSATTAQYKIHKEQSPLCIDTDPINAT
FT                   FHSFKSLKVERLNIMEGDEINPRHFDALIEKIANTQNDVIIDNGASSFVPLSHYLITNQ
FT                   VPTLLKDMGHELIIHTVITGGQALLDTINGFSQLVNQFPEDVRYVVWLNPYWGKIESEG
FT                   KPFEQLKVYKETKDRIAAIINIPDLKEETFGLDLSNMLQQKITFNEAIDSPERNIMTRQ
FT                   RLKLIRDQLFSQIDNAMVI"
     atggcaaaaa tacatatcac gatgcagggc aaaggcggtg tcggcaaatc ctttgtttca        60
     gctaccaccg ctcaatataa aatacataaa gagcaatcac cgctttgtat tgataccgat       120
     cccatcaacg ccacttttca tagctttaag tcacttaaag tcgaacgcct gaatattatg       180
     gaaggcgatg aaattaatcc acgccatttt gacgctttaa ttgaaaaaat tgctaatacg       240
     cagaatgacg tgattattga taatggtgcc agctcatttg tgcctttatc gcattatctc       300
     atcaccaacc aggtgcccac tttgttaaaa gacatggggc atgaactcat catccatacg       360
     gttatcacgg gcggtcaagc actgctggat acaataaacg gcttttctca actggtaaac       420
     caatttcctg aagatgttcg ttatgtagta tggctaaatc cttattgggg aaaaattgaa       480
     agtgaaggaa agccctttga gcaattgaag gtatacaaag agacaaaaga tcgaatcgca       540
     gcaattatca atatccccga cttaaaagaa gaaactttcg gcttagatct atcaaacatg       600
     cttcagcaaa aaattacctt taatgaagca atcgattctc ctgagcgaaa tatcatgacc       660
     aggcagcgat taaagctgat ccgggatcaa ctgtttagcc agattgataa cgccatggtg       720
     atctaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page