(data stored in ACNUC7421 zone)

EMBL: CP000675.PE190

CP000675.PE190       Location/Qualifiers
FT   CDS_pept        208807..209451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54190"
FT                   /protein_id="ABQ54190.1"
FT                   /translation="MCVNNVKNYLKKCSSCNDSGTITGIGGIRSNCSKCKFKRALVNFF
FT                   EKFWAFIINKPIQKYPVGFTIVVFLFYYFISKNFSELMRASSIIGLLGLLFAALKYKLD
FT                   QANYHKSLFDERYKLFCQIEEVIRRANALDATDEGLRMIDEIINRCQFLFGKITLEFII
FT                   EIRSNFIQLICLKKSNKNSAPEADKAMEFFASLITLRSLPSKFPELIISNY"
     gtgtgtgtta acaatgtaaa aaactactta aaaaaatgct ccagttgtaa tgattctggg        60
     acaattactg gtataggagg aataagaagc aattgtagta aatgcaaatt taaacgagct       120
     ctcgtaaatt tttttgaaaa attctgggct tttatcatca acaagcctat ccaaaaatat       180
     cccgtgggat ttacaattgt tgtatttctt ttttattact ttataagtaa aaatttttca       240
     gagctaatgc gagctagctc tataattggg ttgcttggtt tactgtttgc tgcacttaag       300
     tataagcttg atcaagcaaa ttatcataaa tcactttttg acgagcgcta caaattattt       360
     tgccaaattg aggaagttat tagaagagct aatgcattgg acgcaaccga tgaaggatta       420
     agaatgattg acgaaataat aaataggtgc caatttttgt ttgggaaaat tacattggaa       480
     tttattatag aaataaggtc aaattttatc caattaatat gccttaaaaa gagtaataaa       540
     aattcggccc cagaagcgga taaagctatg gagttttttg cttcgttaat tactttaagg       600
     tcactaccaa gcaaatttcc agagttgata ataagtaact attaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page