(data stored in ACNUC7421 zone)

EMBL: CP000675.PE194

CP000675.PE194       Location/Qualifiers
FT   CDS_pept        complement(211746..212399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54194"
FT                   /protein_id="ABQ54194.1"
FT                   /translation="MSTTILNESSQLLLAQTLNELIGRDEKLSPAALARQLGIPTNKIT
FT                   RILNGDVTDPKASTLLQIANYFDITIEQLLGLEPIARQEEIEQQQATRQLPIFEFSKVN
FT                   QSNAAKEWYRWVENEIAGEYYALAIDTDLYEPTFPKNSILIINTDIEPEDRSYILIKKK
FT                   NDPSYCSIKKYVLEGNQIYLYPINPKLPVEIFDDHLYTIAGVILEVHQRLRSKK"
     atgtctacca ctattttgaa tgagtcaagc caattgctat tggcacaaac attgaatgaa        60
     ttgattgggc gtgatgaaaa actatcacct gcggctctcg cgcggcaatt gggtattcca       120
     actaataaaa ttacccgaat cttaaatggt gatgtgactg atccgaaagc aagcacattg       180
     ctgcaaattg ccaattattt tgatatcacc atagaacaat tactgggatt agagcctatt       240
     gctcggcagg aagaaataga gcaacagcaa gccacaaggc aattgcctat ttttgaattt       300
     agcaaggtaa accagtctaa tgcagccaag gaatggtatc gctgggttga aaatgaaatt       360
     gcaggtgaat actacgccct cgcgattgat actgatctat atgagccaac tttccccaaa       420
     aattcaatat tgatcattaa tacagatatt gaaccggaag accgctcata tattcttatt       480
     aagaaaaaaa atgatccttc ttattgctcg ataaaaaaat atgttcttga aggaaatcaa       540
     atctatttat acccaattaa ccccaaattg ccagtagaaa tttttgacga tcatttatac       600
     actattgcag gtgtaatttt ggaagtacac cagaggttgc gctcgaaaaa ataa             654
//

If you have problems or comments...

PBIL Back to PBIL home page