(data stored in ACNUC7421 zone)

EMBL: CP000675.PE196

CP000675.PE196       Location/Qualifiers
FT   CDS_pept        212810..213016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54196"
FT                   /protein_id="ABQ54196.1"
FT                   /translation="MNWVKLKKYCEISGDTSNAVHAKRKRGMWLDGVQCKVGPDGNIWI
FT                   NLVEVERWVENGNKATNIRLRAG"
     atgaactggg taaaactaaa aaaatattgc gaaatatcgg gggacacttc taatgcagtt        60
     cacgccaaac gaaagcgggg tatgtggtta gatggtgtac aatgtaaagt gggacctgat       120
     ggtaacatat ggattaattt agttgaggtt gagcgatggg tggaaaacgg caacaaagca       180
     acgaatatcc ggttgcgcgc gggataa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page