(data stored in ACNUC7421 zone)

EMBL: CP000675.PE199

CP000675.PE199       Location/Qualifiers
FT   CDS_pept        complement(214988..215779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54199"
FT                   /protein_id="ABQ54199.1"
FT                   /translation="MNANQYLNHLATQGQHYFTTKDMIHALKMSHTAAWAAMIRLEKKG
FT                   VIATPHRGFHIIIPPEYQRLGCLPPDQFIPDLMDYLQIPYYVGLLSAAQYYGASHQQAQ
FT                   TFQVIAPKNRKKIQCGQIRIEFIARKNIADIPTTNFNTPKGYVKVSSPEATALDLANYP
FT                   MYCGGLSNVLTTLEELAEQIDPQALERFASQLPHSPQLQRLGFMFESGQLDELALIIET
FT                   ILRKRTIRSVALVPNITNQEIDTPINKRWKIIQNEIVESDL"
     gtgaacgcaa accaatattt gaatcattta gccacccaag gccaacacta ctttacaaca        60
     aaagacatga ttcatgcact taaaatgtca catacagccg cttgggccgc aatgatacgt       120
     cttgaaaaaa aaggggttat tgccacacct catagagggt ttcatattat tatcccccca       180
     gaatatcaac gtctgggttg tctcccaccc gatcaattta ttcctgattt aatggattat       240
     ttgcaaatac cctattatgt cggtctttta agtgccgctc aatattatgg cgcttcgcac       300
     cagcaagcac aaacgtttca ggtgatagca cctaaaaacc gcaaaaagat tcaatgtggg       360
     caaatacgca ttgagtttat tgccaggaaa aatatcgctg acattccgac gacaaatttt       420
     aatacgccta aaggttacgt caaagtatca agcccagaag cgaccgcatt ggatctggcc       480
     aactatccca tgtattgcgg tgggttaagt aatgttttaa ctacattaga agaacttgca       540
     gaacaaatag acccacaagc attagagcgt ttcgcaagcc agctaccgca ttcaccacaa       600
     ctgcaacggc ttggatttat gtttgagtct ggtcaattag atgagcttgc gttgattata       660
     gaaactattt tgcgaaagcg gactatccgc tctgtagcct tggtgcccaa tataacaaat       720
     caggaaatag atacccctat caataaacga tggaaaataa ttcaaaatga aatagtagag       780
     agtgatttat ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page