(data stored in ACNUC7421 zone)

EMBL: CP000675.PE201

CP000675.PE201       Location/Qualifiers
FT   CDS_pept        217598..218434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0203"
FT                   /product="DNA-damage-inducible protein D"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54201"
FT                   /protein_id="ABQ54201.1"
FT                   /translation="MKTEIIHILTTNFESHAHKTDEGVEFWLARDIQKLLGYEKWDNFL
FT                   NVVSKAKTACEISEHNVADHFADVGKMVELGSGSQREINDIMLTRYACYLIAQNGDPKK
FT                   QEIAFAQTYFAYQTRKAELIEQRLLEAERVTARKKLSDTEKELSQVIYEQTNGNENFAV
FT                   IRSKGDHALFGKSTQAMKKQWNVPDSRPLADFAPTIILKAKDFATEITIFNAKEHGMTT
FT                   EQAISKEHVTNNEAVRKTLIDRGITPEKLPPAEDVKKVERRLESEKKKSLKKPDAL"
     gtgaaaacag agattattca tatattaact accaattttg aatcacatgc acataaaaca        60
     gatgagggag tagaattctg gctagcaagg gatatacaaa aattactagg gtatgaaaaa       120
     tgggacaact tcttaaacgt tgtttcaaaa gcaaaaaccg cgtgtgaaat atcagagcac       180
     aatgttgcag accattttgc cgacgtcggg aaaatggttg aattaggttc gggaagccag       240
     cgagaaatta atgacataat gcttacacgg tatgcatgtt atttaattgc acaaaatggc       300
     gaccctaaaa aacaagaaat tgcgtttgct caaacatatt ttgcttatca aacccgaaaa       360
     gctgaattaa ttgagcaacg cttgctagaa gcggagcgag taactgctcg aaaaaaattg       420
     tctgatacgg aaaaagagct ttctcaagtt atttacgaac aaacgaatgg taatgaaaat       480
     tttgccgtaa ttcgtagcaa aggtgatcat gctctttttg gcaaatctac tcaggctatg       540
     aaaaagcaat ggaatgtacc agatagtcgt ccattagctg actttgctcc caccattatt       600
     ctaaaagcaa aagactttgc tactgaaatt actattttta atgccaagga acatggcatg       660
     acaacagagc aagctatttc aaaggagcat gttacaaata atgaagcagt tcgtaagaca       720
     cttatagatc ggggcattac acctgaaaag ctgcctccag ctgaggatgt aaagaaggtt       780
     gagcgtagac tggaatctga aaaaaagaaa tctttaaaaa aacctgatgc attgtaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page