(data stored in ACNUC7421 zone)

EMBL: CP000675.PE202

CP000675.PE202       Location/Qualifiers
FT   CDS_pept        218455..219234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54202"
FT                   /protein_id="ABQ54202.1"
FT                   /translation="MKNERKFLDVASHAFIEATNGLLDLYHEQPAKITLTEEFSKIVLN
FT                   VYQNFMLDVLPSSQCLVDKKNFFSFAILCRSSLDIIIQILWILSLEEDEKLKAIEYFLN
FT                   FEGVDVGQNGKKIYEWQRVFRPTYSSKKTAMELGIDKECIILPLTQHKNKELKLTVFDY
FT                   LSKITHWNPRLLNDLVGCNSEKHLGNAVEHTRMAAISVETFIFCAITFTEIFLKLCLKV
FT                   DEESVNQKTSKIKEKFRGAFAPFYNDIEQETEVVIEV"
     atgaagaatg aaagaaaatt tcttgatgtt gcttcccatg cttttataga ggccacaaat        60
     ggattattgg atttatatca tgaacaacca gcaaaaatca cattaacaga agaattctct       120
     aaaatcgtac tgaatgttta tcaaaatttc atgttagatg ttttgcctag ttcccagtgt       180
     cttgtagaca agaaaaattt tttcagtttt gccattttgt gccgttcatc actagatatt       240
     attattcaaa tattgtggat attaagtttg gaggaagatg agaagcttaa agccatagaa       300
     tattttttaa attttgaagg agttgatgtt ggccagaatg gaaaaaagat ttatgaatgg       360
     cagagagttt ttcgtcctac gtattctagc aaaaaaactg caatggaatt gggaatagat       420
     aaggagtgta taattctccc attaacgcag cataaaaata aagaattaaa attaactgtt       480
     tttgattatt tatccaaaat tacgcattgg aatccaagac tattaaatga tcttgttgga       540
     tgtaactcag agaaacacct cggaaacgca gttgagcata caaggatggc tgctatatct       600
     gttgagacct ttattttttg tgcaataact tttacagaaa ttttcctgaa gctctgtttg       660
     aaggttgacg aagaaagcgt taatcaaaaa acaagtaaaa taaaagaaaa atttcgtgga       720
     gcatttgctc cgttttataa tgatattgaa caagagacag aggtagttat tgaagtttaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page