(data stored in ACNUC7421 zone)

EMBL: CP000675.PE204

CP000675.PE204       Location/Qualifiers
FT   CDS_pept        complement(221543..221800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54204"
FT                   /protein_id="ABQ54204.1"
FT                   /translation="MDDSIFVKGIEELKRLIATQYDLTVSAHKIENGKIIISLANKRKN
FT                   LVLNELNFRDAIEFLPNSPTNDKDKEDRHSLFLEIKNQLS"
     atggacgact caatatttgt aaaagggatt gaggaattaa aaagactaat tgcaacccaa        60
     tatgatctaa ctgttagcgc tcataaaata gagaatggaa aaattataat tagtttagct       120
     aataaacgaa aaaatcttgt tctaaatgag ctgaattttc gtgatgcaat tgaatttcta       180
     cctaatagtc caacaaatga taaagataaa gaagatagac attctctctt tttggaaata       240
     aagaatcagc taagttaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page