(data stored in ACNUC7421 zone)

EMBL: CP000675.PE205

CP000675.PE205       Location/Qualifiers
FT   CDS_pept        221942..222466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54205"
FT                   /protein_id="ABQ54205.1"
FT                   /translation="MNYKKKDRIRVPENHAEKALTLGINSKLKLLVMSKASEWVELPPG
FT                   EIQSISNKHPTKALVIVVRAPMVNGEYVGNHPDLQELTYRDLWLYSSDYYLLEELEKPT
FT                   TGEALEQNQYWLQLRSKAGRAIEKFEPWAAKQQGKINITDDLKGWIKKEITSKAFEIQT
FT                   ISKILQNHYKF"
     atgaattaca aaaaaaaaga tcgtataaga gttcctgaaa atcatgcgga aaaagcatta        60
     actttgggta taaatagtaa acttaagctg ttagtaatgt ctaaggccag tgaatgggtt       120
     gagttacctc ctggggaaat acaatctata tcaaataaac atccgacaaa agctctagtc       180
     attgtagtca gagctccaat ggttaatggt gagtacgtgg gtaatcatcc tgacctacaa       240
     gaacttacat atcgtgattt atggctatat tcttcagatt attatctttt agaagaatta       300
     gaaaaaccaa ctaccggaga agcattagag caaaaccaat attggttaca gttaaggagc       360
     aaagctggcc gtgccatcga gaaatttgaa ccttgggcgg ctaagcagca aggtaaaata       420
     aacataacag atgatttaaa aggatggatt aaaaaagaaa taactagtaa ggcatttgaa       480
     atacaaacca ttagcaaaat tttgcaaaat cactacaaat tttaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page