(data stored in ACNUC7421 zone)

EMBL: CP000675.PE208

CP000675.PE208       Location/Qualifiers
FT   CDS_pept        222938..225343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0210"
FT                   /product="5' DNA primase traC (Replication primase)"
FT                   /note="3' similarity to Hypothetical protein yfjI"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54208"
FT                   /protein_id="ABQ54208.1"
FT                   /translation="MFDTISQFRAAIETSGLVPPENIIPGKMHRFPGIGKTKENKAGWC
FT                   LLFLDQLGGCYGDWSTGLSEIWWGKRNQKLTPDEKAQFKCQVQEAQLKALNEAAAIHQE
FT                   AAKRALSIWNSSKPAEANYPYLLSKNIEPKGIRCYKGLLVTPLRADGKIYSLQFIDPEG
FT                   NKQFLRGGRVAGCYFSLGNPRGADVICIVEGVATGKTINMATGYPVAVAFSSSNLLAIA
FT                   QVMSEQFPEHTLIICADDDADKEGNPGLTKANQAADILGAKVAIPYFGIDRPNKASDFN
FT                   DMAAFSGLDAVAETIRAVLFQSDDNNWPEPFPLSEEINAQPYPLDALPNTVRNAVEEVT
FT                   AFTKAPTPLVASAALAALSLAIQAHVDVKRTEGLISPVSLYLLTIADSGERKSTCDSFF
FT                   MKAIRDYESIAQEKAKPLIKDYQAEISIWEEKYRGVKEQIRILAKTNKPTHEQELRLVN
FT                   LEYEKPVSPLVPRLVYCDVTPEALKWNLAKVWPSGGILSSEAGTVLGSHGMGTESVMRN
FT                   LATLNQLWDGSPIPTERRGSESFTVNGARLTVGFQVQEVTLKHFLDRSNGLARGTGFLA
FT                   RFLIAYPESTQGNRFFTEPPESWFNLAKFNTRISEILNQEVTIDKNGSLSVIQVSLSPE
FT                   AKKAWICFHDVIEGELGVGGELSEISDVASKIADNAARVAALFKVFNQGVTGTINFDEF
FT                   ENASRIVAWHLHEAKRFFSGLALSDDQADIVKLDSWLVRYCHKKKTNIVSRRDVQRNIV
FT                   PIRLRDKKTLDIALNVLVEAKRIRQMQSGKKKGIYINPALLTGDVHDN"
     atgtttgaca ccatttctca atttagagca gcaatagaaa catcaggttt ggtgccccct        60
     gaaaatatta ttcccgggaa aatgcatcgt tttcccggaa tcggcaaaac taaagaaaat       120
     aaagctggct ggtgcctatt atttttagat caattgggtg gttgttatgg agattggtca       180
     acggggctat cagagatttg gtgggggaaa agaaatcaaa aactaactcc agatgagaaa       240
     gctcagttta aatgtcaagt acaagaagcg cagttgaaag cactgaatga agcagcagct       300
     attcatcagg aggctgctaa aagagcgcta tctatttgga atagctctaa accagcagaa       360
     gctaattatc cttatcttct tagtaaaaat attgagccta aaggtatacg ttgttacaaa       420
     ggattattag ttaccccctt acgggcagat ggtaaaatat actcgctaca atttattgat       480
     cctgagggta ataaacaatt tcttagaggg gggcgagtag ctggctgtta ttttagttta       540
     ggtaatcccc gaggggcgga tgttatatgc atcgttgaag gagttgcaac aggaaaaaca       600
     attaatatgg ctacaggtta tcccgtcgct gttgctttta gtagctctaa tcttctagcg       660
     atagcccaag tgatgagcga gcagtttcct gagcatacat taataatctg tgcggatgat       720
     gatgctgata aagaaggtaa tcccggttta actaaagcaa atcaggctgc agatattctt       780
     ggtgcaaaag tagctattcc ttactttggt atagatcgcc caaataaagc atcagatttt       840
     aacgatatgg cagcctttag tggattggat gctgtggctg aaactataag agctgttctg       900
     tttcaatccg atgataataa ttggcctgag ccatttccat tatcagaaga aattaatgcc       960
     cagccatacc ctttagatgc gcttccaaat actgttcgta atgcagtcga agaagtaaca      1020
     gcttttacca aagctcctac gccattagtg gcatccgctg cattagctgc tttatcttta      1080
     gctatacaag ctcatgttga tgttaagcga acggaaggct taattagtcc agtcagttta      1140
     tatttgctaa caatagctga ttctggtgag cgtaaatcta cctgtgatag tttttttatg      1200
     aaggcgatta gagattatga atctatagca caggaaaaag ctaagccttt aataaaagac      1260
     tatcaagcag aaatatctat atgggaagaa aaatatcgag gtgtgaagga acagattcga      1320
     atacttgcaa agactaacaa acctactcac gaacaagaac tgagattagt aaatttagaa      1380
     tatgaaaaac ctgtatcccc tctagttcct cggttggtct attgtgatgt aacacctgaa      1440
     gcgcttaaat ggaatttagc taaagtatgg ccgtcaggag gtattctctc tagtgaagca      1500
     ggtacggtct tgggttctca tggaatgggt acagaatcgg taatgcgaaa tttagctacc      1560
     cttaatcaat tgtgggatgg atcacctatc cctactgagc gccgtggttc tgaatcattt      1620
     actgttaatg gagctcggtt gactgttggt ttccaagtcc aggaagtaac attaaaacat      1680
     tttttagatc gctctaatgg attagcaaga gggacagggt ttcttgctcg atttctaatc      1740
     gcctatcctg agtccacaca aggaaataga ttctttacag aaccaccaga atcttggttt      1800
     aacctagcaa aatttaatac gcgaattagt gaaatattga atcaagaagt gactattgat      1860
     aaaaatggca gcctttccgt tatacaagtt tctttatcac ccgaagcaaa aaaagcatgg      1920
     atatgtttcc atgacgttat cgaaggggaa ctaggtgttg ggggtgaatt aagtgaaatc      1980
     tctgatgttg ccagtaaaat tgctgataat gcggcacgtg ttgcagcttt gtttaaagta      2040
     tttaaccaag gtgttactgg gacgattaac tttgatgaat ttgaaaatgc atcaagaata      2100
     gtggcttggc atctacatga agcaaagcgt tttttttcag gactagcatt atcagacgat      2160
     caggctgata tcgttaaact tgattcatgg cttgttagat attgtcataa gaaaaaaact      2220
     aatatcgtat ctagacgaga tgtacaacgt aatattgtgc caatcaggtt acgtgacaaa      2280
     aagactcttg atatagcttt gaatgtgtta gttgaggcta aaagaatacg tcaaatgcaa      2340
     agtggaaaaa agaaagggat ttatatcaat ccagctttgt taactgggga tgtacatgat      2400
     aattaa                                                                 2406
//

If you have problems or comments...

PBIL Back to PBIL home page