(data stored in ACNUC7421 zone)

EMBL: CP000675.PE209

CP000675.PE209       Location/Qualifiers
FT   CDS_pept        225333..225644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54209"
FT                   /protein_id="ABQ54209.1"
FT                   /translation="MIINNLIKKGFLTNNIMLTSATIATDEPVKISTVAEVATVAVGNL
FT                   NNSCGSLTSNEKQKILSWLEYIGEKDPLIIIEVLEFCRNNVDSRQYFLQRAKEVPEIK"
     atgataatta ataatctaat taaaaaaggc tttctcacca acaatatcat gttgacatca        60
     gcgacaattg cgacagatga acccgtaaaa atatcaactg tcgcagaagt cgcaactgtc       120
     gcagtaggga acttgaataa ttcatgcgga tcgttaacca gtaatgaaaa acaaaaaata       180
     ctttcttggt tagaatatat tggtgaaaaa gaccctttaa tcattattga agtgttggaa       240
     ttttgcagaa ataatgtaga ttcacgacaa tattttttac aaagagcgaa agaagtacct       300
     gaaataaaat aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page