(data stored in ACNUC7421 zone)

EMBL: CP000675.PE21

CP000675.PE21        Location/Qualifiers
FT   CDS_pept        26021..26932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0021"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54021"
FT                   /protein_id="ABQ54021.1"
FT                   /translation="MAFFLITLCILILSFFCLAVMVLKFMQQPSSPLSFSQYVKLMCSG
FT                   VIAFIADTVGVGSFAVNVALAKLLGTFRDDELPAVNNGAQVLPGAIESLFFIHMVDVDL
FT                   TTLLTLVTGTCIGGLVGGFVVSQLSKQAIRLAMICSFALIIVLLIAHQLRLLPVGGDLT
FT                   ELHSWKLVIGFFAMVVCGSLTSVGVGLFVMVQGVLFLMNVSPVVAFPIMTTAGAMQQPL
FT                   TTLVFLQKNKIPLKKTLILSFSGCLGVMITIPIFTKLTITWLHFLLLFILIYNFLAIGH
FT                   TYLRSRPVKQYVQSSVKLAAAD"
     atggcatttt ttttaatcac gctttgcata ctaatattga gttttttctg cctggccgta        60
     atggttttaa aatttatgca gcagccttcc tcgcctctat ccttctccca atatgttaaa       120
     ttaatgtgta gcggagttat tgcctttatt gcagatacag tgggggtcgg cagtttcgcc       180
     gttaatgtag ccttggcaaa attattaggc acttttcgtg atgatgaatt acctgctgta       240
     aataatggcg ctcaagtcct ccctggcgct atcgaatctt tatttttcat acacatggta       300
     gatgttgatt taactacgct acttacttta gttaccggaa cctgtattgg tgggttagta       360
     ggtggttttg tagtgagcca gttaagcaaa caagccatta gactggcaat gatttgttca       420
     tttgccttaa tcattgttct tttaatcgct catcaattgc gcctgttgcc agtaggtggt       480
     gatttgacag aattgcattc ctggaagctg gttattggtt tttttgctat ggtagtgtgt       540
     ggctctctta cctctgtcgg agtagggctt tttgtcatgg tgcaaggggt tttattttta       600
     atgaatgttt caccagttgt cgcttttcct atcatgacaa ctgcaggagc catgcaacag       660
     ccgctgacca cattagtttt tttacaaaaa aataaaatcc cgttaaaaaa gactttgatt       720
     ttaagctttt caggatgtct gggtgttatg atcaccattc caatttttac aaaattaaca       780
     ataacctggc tgcatttttt acttttattt atccttatct ataatttttt agcaattggt       840
     catacttatt tacgctcaag acctgtcaaa caatacgtcc aatcatctgt taaacttgcg       900
     gcagcggact ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page