(data stored in ACNUC7421 zone)

EMBL: CP000675.PE210

CP000675.PE210       Location/Qualifiers
FT   CDS_pept        225704..226078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54210"
FT                   /protein_id="ABQ54210.1"
FT                   /translation="MKFKPGESGNPSGRPKGSRNIQTQLIKLLEPHAEQLINKMVEKAL
FT                   EGDPHALRLCIERLLPKAKHNPIESDLLTLEEDNYMETIESILQEMLLGNIASDEGKKI
FT                   IDLIEEHQNRKRFDSLIHIP"
     atgaaattta agcccggaga aagcggtaat ccatcaggtc gaccgaaggg atctcggaat        60
     attcaaaccc agttgattaa attgcttgag ccgcatgcag agcagttgat aaataaaatg       120
     gttgaaaagg cgctagaggg agatcctcat gcgctacggc tttgtattga gaggttatta       180
     ccaaaagcga aacataaccc tatagagagt gatttactaa ctctagaaga agataattat       240
     atggagacaa ttgagtctat tttgcaggaa atgctgctag gaaatattgc ttctgatgaa       300
     ggcaaaaaaa ttatcgatct tattgaagag catcaaaata ggaagaggtt tgactcattg       360
     atacatattc cataa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page