(data stored in ACNUC7421 zone)

EMBL: CP000675.PE212

CP000675.PE212       Location/Qualifiers
FT   CDS_pept        226936..227196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54212"
FT                   /protein_id="ABQ54212.1"
FT                   /translation="MSTFLMKEKHPNLIKIGKLIRDTRKEKGYSQEDFASQAQLGRTYM
FT                   GRIERGEQNMTIQTLIQIALILGVEVATLIPKLNELTPPKA"
     ttgtctactt tcttaatgaa agaaaaacat cctaatctta taaaaatagg caaattaatc        60
     agggatacca gaaaagaaaa agggtattct caagaagatt ttgcttccca agctcaatta       120
     gggcgtacct atatgggtag aattgaaagg ggtgaacaaa acatgactat tcaaacactt       180
     atacaaatag cattaatttt aggagtggaa gttgctacac ttatccctaa attgaacgag       240
     cttactcccc ctaaagcttg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page