(data stored in ACNUC7421 zone)

EMBL: CP000675.PE216

CP000675.PE216       Location/Qualifiers
FT   CDS_pept        233982..234959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0219"
FT                   /product="Mrr restriction system protein (EcoKMrr)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54216"
FT                   /protein_id="ABQ54216.1"
FT                   /translation="MRSLGYTYFNELNIKRNFMTIPTYQECMLPMLKVLKDNSNIKSTR
FT                   LISLMGDWFHLSDDEREELLSSGRTTILRTRVHWAKVYLKQAGLVEYPKRGYVAITEKG
FT                   IQVLQKNPSNIDTNYLKKFPDFIRFIERSKTESQQVSNSEYSENYSPDEVLTRTFERMK
FT                   NQTCEELLEVIKSSSPQFFEKLVVQVIVSLGYGGSLQEAGQAIGKSGDGGVDGVIKEDR
FT                   LGLELIYLQAKLKKDDKYNVGRPDIQKFYGALQGKQAKKGIFITTTDFSNEAREYLKVI
FT                   DKKIILLNGKELIELMWEYNIGLNVSATYEVKDLDLDFFKEELE"
     atgagaagtc ttggctatac ttatttcaac gagttgaata ttaaacggaa ttttatgacg        60
     ataccaactt atcaagaatg tatgctacct atgttgaaag ttcttaagga taatagcaat       120
     ataaaatcca ctagattaat aagtctgatg ggtgattggt ttcatttgtc agatgatgag       180
     cgtgaagagt tattatccag tgggagaaca acaatattaa gaacaagagt gcattgggcc       240
     aaagtatatc tgaaacaggc tggtttagtt gaatatccta aaagaggtta cgttgctata       300
     acagagaagg ggattcaagt attgcaaaaa aatccctcga acattgatac taattatctt       360
     aaaaaatttc ctgattttat tagatttatt gagagatcaa aaacagaaag tcaacaggtt       420
     agtaatagtg aatatagtga aaattattcc cctgatgaag tattgactag aacttttgaa       480
     aggatgaaaa accagacatg tgaggagctt ctggaagtaa taaagtcaag ttctcctcag       540
     ttttttgaaa aacttgtagt gcaggttata gttagtctcg gatatggtgg ctcactacag       600
     gaagcaggcc aagctatagg aaagtctgga gatgggggag ttgatggggt aataaaggaa       660
     gacaggcttg gtttagagtt aatttattta caggcaaaat tgaaaaaaga tgacaaatat       720
     aatgtggggc ggcctgacat acaaaagttt tatggtgctt tgcagggcaa gcaagctaaa       780
     aagggaatat ttatcacaac cactgatttt tcgaacgaag ctagagaata tctcaaagtt       840
     atagataaaa aaattattct attgaatggt aaggaattga ttgaattaat gtgggaatat       900
     aatatcggat taaatgtttc tgcaacttat gaagttaaag atttggactt ggattttttt       960
     aaagaagaac tcgaatag                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page