(data stored in ACNUC7421 zone)

EMBL: CP000675.PE217

CP000675.PE217       Location/Qualifiers
FT   CDS_pept        235158..235505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54217"
FT                   /protein_id="ABQ54217.1"
FT                   /translation="MVRLLRIEFSGGLYHINSRGNRKEAIYLSDADRENFLSVLGDVCL
FT                   KYQWLCHSYCLMTNHYHLLIETPLGNLSKGMRYLNGVYTQKFNKSHKRIGHVLQGCYKS
FT                   ILVTTQEFAEL"
     atggtaagac ttttgcgcat tgagttttct ggtgggctct atcacatcaa cagtcgaggg        60
     aatagaaaag aagcgatcta tttatcagat gcagacagag agaatttttt atctgttttg       120
     ggtgatgttt gtttaaaata tcagtggtta tgccattcgt attgtctgat gacaaatcat       180
     taccatttac ttattgaaac tccgctcggt aacctttcaa aaggaatgcg ctatctgaac       240
     ggggtataca ctcagaaatt taataaatca cacaagcgta ttgggcacgt cctgcaaggt       300
     tgctataaat ctatattggt cactactcaa gaatttgcag aattataa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page