(data stored in ACNUC7421 zone)

EMBL: CP000675.PE22

CP000675.PE22        Location/Qualifiers
FT   CDS_pept        27124..27603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0022"
FT                   /product="conserved hypothetical protein; DUF615"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54022"
FT                   /protein_id="ABQ54022.1"
FT                   /translation="MDEQISKSQKKRDAHYLQDIGIKFIDLSASKLDSLPLPDNLRQAI
FT                   IDARSIKSHGAKRRQAQLIGKLMRAADFEAILAAYEKILEEESSITASFHEIELWRDRL
FT                   LQDGKDALTEFIDAYQPEDVQQLRQLIKKALDDQMKEKNTGAAKALFRYLRSLIK"
     atggatgaac aaatcagtaa atcacagaaa aaaagagatg ctcattattt acaagatata        60
     ggcattaaat ttattgattt aagcgcatcc aaactggatt ctttgcccct tcccgataat       120
     ttacgtcaag caattattga cgccaggtca atcaaaagcc atggggctaa aagacgacag       180
     gcgcaattaa taggcaaatt aatgcgtgca gctgattttg aagccattct tgctgcctat       240
     gagaaaatcc ttgaagaaga gagttcaatt acggcctctt ttcatgagat agagctatgg       300
     cgcgacaggt tattacaaga tggaaaagac gctttgacag agtttattga tgcctatcaa       360
     cctgaggacg tgcaacaatt aaggcaactg attaaaaagg cattagatga tcagatgaaa       420
     gagaaaaata caggcgctgc taaagcactg tttcgctatt taaggtcttt aataaaatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page