(data stored in ACNUC7421 zone)

EMBL: CP000675.PE221

CP000675.PE221       Location/Qualifiers
FT   CDS_pept        237637..237777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54221"
FT                   /protein_id="ABQ54221.1"
FT                   /translation="MPGLENKLMKVEDSEESHIKFVSQVESSSAIRRKIINSIKQILGN
FT                   S"
     atgcctggtc ttgaaaataa gcttatgaag gtagaggata gcgaagaaag ccatattaaa        60
     tttgtatctc aagtcgaatc ctcatcagca attagaagaa agataattaa ttcaataaaa       120
     caaattttag gtaattctta a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page