(data stored in ACNUC7421 zone)

EMBL: CP000675.PE225

CP000675.PE225       Location/Qualifiers
FT   CDS_pept        241325..241840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54225"
FT                   /protein_id="ABQ54225.1"
FT                   /translation="MFNVSIRKATSLDAEAIASVHVHSWKKAYQQFIPEIVLNSLSIPE
FT                   RTQLWNELLNNGVTVLVLEIDNQIIGFASICTFRDGIEDNSKGEISAIYIHPNFWHQGF
FT                   GKKLSLAALKTLKELGYTEALLWVLSDNHQARSFYEGMGFELNDKSKLAEFYDGGALLK
FT                   EVLYKKKL"
     atgtttaatg tttctattag aaaggctacc tctttggatg cggaggcgat tgcatcagta        60
     catgttcatt cttggaaaaa agcctatcaa caatttattc cagaaatagt actcaatagt       120
     ttatcaattc ctgagcgcac ccaactatgg aatgaactac taaataatgg cgtaacagta       180
     cttgtattgg aaattgacaa tcaaataatt gggtttgcga gtatttgtac atttcgcgat       240
     ggcattgagg ataattctaa aggggaaatt agtgctattt atatacaccc caatttttgg       300
     catcaaggat ttggtaagaa attgtctctc gctgcgttaa aaaccctaaa agaactaggc       360
     tataccgaag ctttgctttg ggttttatca gataatcatc aagcgcgtag cttttatgaa       420
     ggcatgggct ttgaattaaa tgataaatca aaacttgcgg agttttacga tggtggagcc       480
     ttattaaagg aggtgctgta taaaaagaaa ttataa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page