(data stored in ACNUC7421 zone)

EMBL: CP000675.PE226

CP000675.PE226       Location/Qualifiers
FT   CDS_pept        complement(242290..242514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54226"
FT                   /protein_id="ABQ54226.1"
FT                   /translation="MKPIKNSKEQEHIAPEAQDPRLSYTEDDRRPLTSTTSAKHPSSLF
FT                   GKSEERSARESYDQYGNNVSTHWTQGPWN"
     atgaaaccta taaaaaacag caaagaacaa gaacatattg ctcccgaagc tcaagacccc        60
     agattgagct acactgagga cgatcgtcgc ccactaacga gcacaacatc agcaaaacat       120
     cctagtagtt tgttcggcaa atcggaagag cgctcagcaa gggagagtta cgatcaatat       180
     ggtaacaatg ttagtaccca ttggacacaa ggcccctgga attaa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page