(data stored in ACNUC7421 zone)

EMBL: CP000675.PE227

CP000675.PE227       Location/Qualifiers
FT   CDS_pept        complement(242731..243045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54227"
FT                   /protein_id="ABQ54227.1"
FT                   /translation="MKLTLFLVLVWICTESFGTTIMVKGLPSPLEYRNDLYYWPPNVAI
FT                   SPDTTNLFITMDGIDKVCFLNTGLQGGLEQISEISIIINGAKKDWNCFPYTTTILEARP
FT                   "
     atgaaactca ccctattttt agtattagtg tggatttgca ctgagtcttt tgggacaact        60
     atcatggtaa aagggctgcc atctccttta gagtacagaa atgatcttta ttattggcct       120
     ccaaatgttg ctatcagccc tgacactact aatttattca ttacaatgga tggcatcgac       180
     aaggtgtgtt tcttgaatac aggactccaa ggtgggttag agcaaatttc agagattagt       240
     attatcatca atggagcaaa aaaggattgg aactgtttcc catataccac gactattctt       300
     gaggcacgcc catag                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page