(data stored in ACNUC7421 zone)

EMBL: CP000675.PE228

CP000675.PE228       Location/Qualifiers
FT   CDS_pept        243449..244885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54228"
FT                   /protein_id="ABQ54228.1"
FT                   /translation="MTPLFPQKGQPIAIKQGRSGSCFLLACLDCLLNGEAEGAGVVRKK
FT                   FKQTTSGVTLRIKRTDNTMKVQWEKMAGKYTYSYDPRTDEDVIFIDNEKLKEIDNSKKG
FT                   SSSNSLAVKILEHISAYYYQIAWDGESLLAHKLHPKFRNNPIAKQSDTAFLAKLLGVHV
FT                   TSFYDPHKLVKLKTIDPMIPVYVGMNFGKLDRLGRHRRHALRVGNIKPLDDGEYEVTLI
FT                   NPWNNQKQTTCLLTDLRKRKCHFAVFDSSPQKKLLTEIFLEYKTEIGCELFRNKELAFL
FT                   LCEMKQCGLLDSELAKYPLSSCMVLYKKLPNLVANYRCLPYSERYNMLMCVASTNGHVR
FT                   LFNKLMQGSSVVDKPSVARSPQRPYLSAKSFFADLFASLEASLERVHYNDLLKTLRVNY
FT                   GHLRSVNTALNQVENRQGIYSKMELKNMNQRLDRLGFFMKCHTDPRGHRNSDLGQQPNF
FT                   FDQSTQKVNVKNHQNKGVSL"
     atgacgccat tatttccgca aaaaggccag cctatagcca taaaacaagg caggagtggg        60
     tcttgctttc tcctggcttg cctggattgt ttgctcaacg gtgaagcaga aggggccggt       120
     gttgtacgga aaaaattcaa acaaacaacg tccggcgtta ctcttagaat taaacgcact       180
     gacaacacca tgaaggtgca gtgggaaaaa atggctggga agtatactta ttcttatgat       240
     cccagaactg atgaagacgt tatttttatc gataatgaaa aattaaaaga aattgataac       300
     agtaaaaaag gatccagttc caattcgctc gcagtaaaaa ttttagagca catcagcgct       360
     tactactacc aaattgcctg ggatggcgaa agtcttttgg ctcataagct acacccaaaa       420
     tttcgcaata atcctattgc caagcaaagc gatactgcat ttctagccaa gcttttggga       480
     gttcatgtca cttctttcta tgacccgcac aagctggtta agcttaaaac aatagacccc       540
     atgattcctg tttatgtagg gatgaacttt gggaagctgg atagattggg caggcacagg       600
     cgtcatgcac tacgtgttgg aaatattaag cctttagacg atggagagta tgaggttact       660
     ttaatcaatc cctggaataa tcagaaacaa accacctgtt tgctcactga cctgaggaaa       720
     aggaaatgtc attttgccgt atttgacagc tctccacaaa aaaaattatt aacagaaatt       780
     tttttggaat ataagaccga gataggatgt gaattatttc gcaacaaaga attagctttt       840
     ttgttatgcg aaatgaaaca atgtggttta ctggatagcg agcttgcgaa atatccgcta       900
     agttcatgta tggttttgta taaaaagctc ccgaatttgg ttgcaaacta caggtgtctt       960
     ccctatagcg aacgatacaa tatgttaatg tgtgttgcta gcaccaatgg tcatgtgcgt      1020
     ttattcaata aactaatgca agggtcgtca gtagttgaca agccatctgt ggccaggtcg      1080
     ccacagcgtc catatctcag tgcaaaatca ttttttgctg acttgttcgc atcgctggaa      1140
     gcgtctttgg agcgggtgca ctacaatgat ttactaaaaa cactaagagt caactacggc      1200
     catttgcgtt ctgtcaatac ggcgttaaat caagttgaaa atagacaagg gatctactct      1260
     aaaatggaat taaagaacat gaatcagcgt cttgatcgcc taggtttctt tatgaagtgc      1320
     catactgacc caagaggcca tcgcaactct gaccttggac aacagccaaa cttttttgac      1380
     cagtcgactc aaaaagtgaa tgttaaaaac catcaaaata aaggcgtttc gctttga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page