(data stored in ACNUC7421 zone)

EMBL: CP000675.PE230

CP000675.PE230       Location/Qualifiers
FT   CDS_pept        246366..247076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0233"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54230"
FT                   /protein_id="ABQ54230.1"
FT                   /translation="MSPIPAFVIRNLTKTYLMGEVVIHALRCINLDLYQGELVVFLGPS
FT                   GSGKSTLLNIIGGLDVPSSGEVIYKDHLITSASQHDLTRYRREHIGFVFQFYNLISNLT
FT                   ALENVSIVTEIAENPMHPEDAIKLLGLEHRMHHFPAQLSGGEQQRVAIARAIAKNPDVL
FT                   LCDEPTGALDCETGKIVLATLALANQKLKTTVVIITHNIVISEMADRVIHIADGVISNI
FT                   SKNKFKRKPEELEW"
     atgtcaccga ttccagcatt tgttattcga aatttgacta aaacctattt aatgggtgaa        60
     gttgtcattc atgctttacg atgcataaat ctcgacctgt accagggaga gttggtcgta       120
     tttttaggcc catcaggaag tggcaaatcc acattattga acattatagg agggctagat       180
     gtcccttcat cgggtgaagt aatttacaag gatcacctca tcacctcagc cagtcaacat       240
     gatttaactc gctatcgtcg tgagcatata ggatttgtgt ttcaatttta taacctgatt       300
     tcgaatctta cggctttgga aaatgtttct attgtcactg aaattgctga aaaccccatg       360
     cacccggaag atgcaattaa attacttggt ttagagcatc gtatgcatca tttccccgcc       420
     caactctccg gtggagaaca acagcgggtc gcaatagctc gggcaatagc caaaaatcct       480
     gatgttctct tatgtgatga gccaacaggc gcactcgatt gtgagacagg taaaatcgtt       540
     ttagcgacac ttgctttggc gaatcaaaaa ttaaagacga cagttgtcat tattacccat       600
     aatattgtca taagcgagat ggctgatcgt gtgatccata ttgctgatgg tgtcataagc       660
     aacatatcca agaataaatt caagcgcaaa ccagaagaat tagaatggta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page