(data stored in ACNUC7421 zone)

EMBL: CP000675.PE232

CP000675.PE232       Location/Qualifiers
FT   CDS_pept        249436..250635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54232"
FT                   /protein_id="ABQ54232.1"
FT                   /translation="MKIMNLNLKKLIGYFLAIVIFFSVVLWFLSHQGISVERAKVKYDH
FT                   FIQYIEDDAKTRAIKIYSIVSPVSGELLRINLTEGDKVKKDDVIATIKSKIPALLDIRA
FT                   KQELEHELGTAEALYEQAKAESIRAEAALETAQSDFKRKEPLAKKGFVSETELEHAQLE
FT                   YQLRQKEHNAALRKLHAAEHYILKVKASLSASEGSEASQQDKIEIRSPVTGSILRVIEK
FT                   SSTTVEPGTKIMDIADVVGLEVVADILSDDAAKIPPYARVIIKRWGGPYPLEGRVRIVE
FT                   PSGYTKISALGVEEQRVNVIIDITTPYELWKNLGDGYRVDVEIILFESNHALVVPMSAL
FT                   FRDGEDWAVFVVKGHRAYKKKLTIKYHNPDYAVIERGLELGDEVILYPSSLIHDGVLIK
FT                   "
     atgaagataa tgaacctgaa tttgaaaaaa ctaatagggt attttctggc aatagtgata        60
     tttttcagtg ttgttctctg gttcctttct catcaaggta tttcagttga aagggcaaaa       120
     gtgaaatatg atcacttcat tcagtatatt gaagacgatg cgaaaacgcg tgctataaaa       180
     atatacagta ttgtgtctcc agtgtcagga gaattgttac gcattaattt gacggaaggt       240
     gataaagtaa aaaaagatga cgtaattgcc actattaagt ctaaaatacc tgctttgctg       300
     gacattcgag caaagcaaga attagagcat gagttgggca ctgctgaggc cttgtatgaa       360
     caggcaaagg cagagtcaat tcgcgctgaa gcagcactgg agacggccca gtcagatttc       420
     aaaagaaaag agccactggc aaaaaaaggg ttcgtttcgg aaacagaatt ggagcatgct       480
     caattggaat atcaattaag acagaaagaa cataatgccg cattgcgtaa gttacatgct       540
     gcagagcatt acattttaaa agttaaagca tccctttcgg catcagaggg cagtgaagcg       600
     agtcagcaag acaagattga gattcgttca cctgtaacgg gctcgatttt gagagtgatt       660
     gaaaaaagtt caactaccgt tgagcctggc acaaaaatta tggatattgc cgatgtggtc       720
     ggtcttgaag ttgtggctga catattaagc gatgatgccg caaaaattcc tccgtatgca       780
     agagtcatca taaaacgatg gggagggcct tatcctttgg aagggcgcgt tcgaattgtt       840
     gagccaagcg gttatactaa aatatcagcg cttggagttg aggaacaacg agtcaatgtc       900
     atcattgata tcacgacccc atatgaatta tggaaaaatc ttggtgatgg atatcgggtg       960
     gatgttgaaa ttattctttt tgaatcgaac catgctcttg tagtgcctat gagtgcttta      1020
     tttcgagacg gggaagattg ggctgttttt gtcgtgaaag ggcacagagc ttataagaag      1080
     aagttaacta taaaatatca taacccagat tacgcggtaa tagagcgtgg tttagagtta      1140
     ggcgatgaag tcattcttta tcccagctct ttaattcatg atggggtctt aattaaataa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page