(data stored in ACNUC7421 zone)

EMBL: CP000675.PE233

CP000675.PE233       Location/Qualifiers
FT   CDS_pept        complement(250707..251585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0236"
FT                   /product="sensory box (GGDEF/EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54233"
FT                   /protein_id="ABQ54233.1"
FT                   /translation="MLTNIERAKLQLIDETSDMVIITKADPLDAPNGPEVVWVNKAFEK
FT                   ISKYKANEIIGQTPRILQGKETNQNTLKMIREAMKAQTSINVELLNYTKDGTPYWINFS
FT                   IVYLRDGQGNLCYLGAIERDITAIKNLNFQLSEKAKTDPLTNVYNQENFFIAGNEAIKN
FT                   FHQNQEAVGLLFFDVDDFKGINDTQGHIYGDKILKKVAQESLKLVRKTDNVFRYGGDEF
FT                   AIIFSGIDVKILERKAQQLQKKLAKSHISVSIGGTISKQSDKSINTLLARADEALYYVK
FT                   ANKKGLFFIRE"
     atgcttacaa acattgaaag agcaaaactt caattaattg atgaaaccag cgatatggtc        60
     attataacca aagcggatcc acttgatgca cctaatggtc cggaagtggt ttgggtaaat       120
     aaagcctttg aaaaaatttc aaaatataaa gccaatgaaa ttattggcca aacaccacgt       180
     atccttcaag gtaaagaaac caatcaaaac acattaaaaa tgataagaga agcaatgaaa       240
     gctcaaacga gtatcaatgt ggagttatta aattatacta aggatgggac accttattgg       300
     attaattttt caatagtata tttgagagac gggcagggta atttatgtta tttgggtgca       360
     atagaaagag atatcaccgc aatcaagaat ttaaattttc aattatctga aaaagcaaag       420
     actgatccgc ttaccaacgt ttacaatcag gaaaatttct tcatcgcagg gaatgaagct       480
     attaaaaatt ttcatcaaaa ccaggaagca gttggattat tatttttcga tgtggatgat       540
     tttaaaggaa taaacgatac gcaagggcat atctatggcg ataagatact aaaaaaagtt       600
     gcccaggaat ctttaaagct tgtccgtaaa acggataacg tatttcgata tggcggcgat       660
     gagtttgcta ttattttttc aggcattgat gtgaaaatcc tggaaagaaa agcacaacaa       720
     ctacaaaaaa agctggcaaa atctcacatc tcagtgagca ttggagggac tatttcaaag       780
     caaagtgaca aatcgataaa taccctcttg gcgagagcgg atgaagcact ctattacgtc       840
     aaagccaaca aaaaagggtt gttttttatc agagaataa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page