(data stored in ACNUC7421 zone)

EMBL: CP000675.PE236

CP000675.PE236       Location/Qualifiers
FT   CDS_pept        complement(252868..253080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54236"
FT                   /protein_id="ABQ54236.1"
FT                   /translation="MGIVKISDELHEATKLMARAMSRSINSQAEYWIRIGKLAEENPSI
FT                   TYTDILKILVHQASLGEIYDVSEDV"
     atgggcatag taaaaatttc ggacgaactg catgaagcga ccaaattgat ggcaagagcc        60
     atgagtcggt caatcaactc acaagcagaa tattggatta gaataggaaa attggcggaa       120
     gagaatccat ccattaccta tactgacatt cttaaaattt tagtccatca agcttcacta       180
     ggtgaaatat acgatgttag tgaagacgtc tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page