(data stored in ACNUC7421 zone)

EMBL: CP000675.PE24

CP000675.PE24        Location/Qualifiers
FT   CDS_pept        complement(29793..30335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54024"
FT                   /protein_id="ABQ54024.1"
FT                   /translation="MKSFIEQAQFYATYHQNPATRYTHMAGVPLIMLSIMIFLGFVKIV
FT                   IPGVYATDLACLATLAALIYYFLLNWQLALALTPILIFLLWLASWFNYDGPTKFGLWVF
FT                   IITFVVGWGLQFYGHFIEGKKPAFMVNFTQALIAPLYLTAELFFMAGLMNSLREQIYGN
FT                   EEVNTEEISKTKTKSKS"
     atgaaatcgt ttattgagca agctcaattc tatgcaacct accaccaaaa cccagcgaca        60
     cgttacacac atatggcagg agtcccgtta atcatgcttt ctatcatgat ttttctggga       120
     tttgttaaaa tagttattcc aggtgtttat gcaaccgatc ttgcttgttt ggctacgctt       180
     gccgctctca tttattactt cctgttaaac tggcaacttg ccttggcatt aactcccatt       240
     ttgatctttt tgttatggct ggccagttgg tttaactatg atggcccaac gaaattcgga       300
     ctttgggtat ttattattac ttttgttgta ggctggggat tgcaatttta cggtcatttt       360
     attgaaggaa aaaaacctgc ctttatggtt aattttaccc aagcccttat tgcgcctttg       420
     tatttaacag cggaattgtt ctttatggca ggactcatga actccctgag agaacaaatt       480
     tacgggaatg aagaagtaaa tactgaagaa attagcaaaa ccaaaacaaa atccaaatct       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page