(data stored in ACNUC7421 zone)

EMBL: CP000675.PE241

CP000675.PE241       Location/Qualifiers
FT   CDS_pept        complement(255992..256450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54241"
FT                   /protein_id="ABQ54241.1"
FT                   /translation="MPDIDLLPNHCHIMKTYRKELWFNIPERMGFINITDKVIECLKES
FT                   SIQEGLILINAMHITASVFINDDESGLHQDYKKWLEQIAPHEPIRQYRHNDTGEDNADA
FT                   HIKRQIMGREVVVAITEGRLDFGPWEQIFYGEFDGRRDKRVLVKIIGQ"
     ttgccagata ttgatttatt gccaaatcat tgtcacatca tgaaaacgta ccgaaaagaa        60
     ctatggttta atatcccgga gcgtatggga tttattaata tcacagataa agtcattgaa       120
     tgcttaaagg aaagtagtat tcaggaaggt ttaatattga tcaatgccat gcatatcacc       180
     gcttccgtat tcatcaatga tgatgaaagc ggcttgcatc aagattataa aaaatggctt       240
     gaacaaatag caccccacga acccattagg caataccgcc ataatgacac cggcgaagat       300
     aatgctgatg cccatatcaa acgacaaatc atggggcgag aagtggtcgt cgctattaca       360
     gaaggaagac tggattttgg cccatgggag caaatattct atggtgaatt tgacggtcgc       420
     cgtgataaaa gagtccttgt aaaaattatc ggccaataa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page