(data stored in ACNUC7421 zone)

EMBL: CP000675.PE246

CP000675.PE246       Location/Qualifiers
FT   CDS_pept        complement(259987..260697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0249"
FT                   /product="conserved hypothetical protein containing DUF330
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54246"
FT                   /protein_id="ABQ54246.1"
FT                   /translation="MKNQKHFLKFYCIRDRSWPASARASFEGIRFLSFSNYAEFRKKPV
FT                   KLLLLLLIVLTLCDCGRSKETQFYLLTPISPQKNSHNSYNHLQIGVDEVSIPDYMKKPQ
FT                   LMIHQTPHHLTLEEFNQWAGALDKNITLVLTTNLSTLMPGVVVQTSPWDNKFHPDYHLQ
FT                   VMISQFEIDIHGNSILRAEYLIYRKEELIYKGNAYYHIKVPLISIETLVQSMNTNLTHL
FT                   TEEIARFFIKNTTK"
     atgaaaaacc agaaacattt tttaaaattc tattgcatcc gcgataggag ttggccggct        60
     agtgcccgag cctcttttga aggcattcga ttcctatctt tttcaaacta tgccgaattt       120
     cgcaagaaac ctgtgaagct cctcctccta ttgctcattg tcttaaccct ctgtgattgc       180
     ggtcgaagca aagaaactca attttattta ttaacaccta tctcccctca aaaaaatagt       240
     cataattcct ataatcattt acagattggt gttgatgaag tgagtattcc tgattatatg       300
     aaaaaacctc aattaatgat tcaccagaca cctcatcacc taactctcga agaatttaac       360
     caatgggctg gggccttgga taagaatatt actcttgtat taactactaa tctttcaact       420
     ttaatgccag gagtagtagt tcagacctca ccttgggaca ataaattcca cccggattat       480
     catcttcaag taatgatttc acaatttgaa attgatattc atggtaacag tattttaaga       540
     gccgaatacc ttatttaccg aaaagaagag ttaatctaca aaggaaatgc ttattaccat       600
     attaaagtcc ctttaatcag tattgaaacg cttgtgcaga gcatgaatac gaaccttact       660
     catttaactg aagaaattgc acggtttttt ataaaaaaca cgactaagta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page