(data stored in ACNUC7421 zone)

EMBL: CP000675.PE247

CP000675.PE247       Location/Qualifiers
FT   CDS_pept        complement(260694..261380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0250"
FT                   /product="probable transmembrane protein; conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54247"
FT                   /protein_id="ABQ54247.1"
FT                   /translation="MILGGTFFYIEYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIG
FT                   EVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVA
FT                   EIELIKPTPTVKYRQTYYHSYPVFPTHNSAEKYTSMEEAFEAAKKAFEDVSELVRSKEI
FT                   QDTLEAIQKVSENLGQLASSLNQDVPSVVAYLNQSLKQITSAAYSTQNLTDYLSRYPES
FT                   LLRGKR"
     atgattctag gcggtacttt tttttatata gaatacaaac gcgcacaaaa acaaactttt        60
     gtcatgtttt tcaaaggctc tttaaaaggg ctagttacta ctgccccagt aacctatcga       120
     ggcgtgaaga ttggtgaagt caaagtcata gaaatcaccg aaaataaaga gcacagtaaa       180
     gtacttattc ctgtgtacgt ccagtttttt gtcgagagaa cctatggttt tagtcaagac       240
     cctattcacc tgcttattga taatgggtat gtagcaaaca tcaccaaacc aaacctgcta       300
     acgggcgttg ctgaaattga gttgattaag ccaaccccaa ctgtaaaata tagacaaact       360
     tactaccatt cttatcccgt ttttccgact cacaattcgg ctgaaaaata tacatctatg       420
     gaagaagcgt ttgaggcagc gaaaaaagct tttgaagacg tcagtgaatt agttcgttcc       480
     aaagaaattc aagatacttt agaggcgata caaaaagttt ctgaaaattt agggcaacta       540
     gcctctagct taaaccaaga tgtgcccagt gttgttgcgt atttaaatca aagcttaaaa       600
     caaattacca gtgcagctta ctccactcaa aatttgacgg attatttgtc tcgatatcct       660
     gagtctttac tccgaggcaa gcgatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page