(data stored in ACNUC7421 zone)

EMBL: CP000675.PE250

CP000675.PE250       Location/Qualifiers
FT   CDS_pept        262869..263567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54250"
FT                   /protein_id="ABQ54250.1"
FT                   /translation="MTTLYIKNLRYNEVAVCRALFEAAEKTEEGIKTKRYGMQLTADMP
FT                   GLWSPLSNYDIENDLRMARIHRNGRMREIGYLTVNLVFQFDSLDVTEYETKYGISAKDV
FT                   LEKAGFTCSQDAAGYSEPVSTSTRLLGQESKPEKPTQTSVVNTSFFSLKSVDTDKRFTK
FT                   STKPGILYEARSYGKIEDDTLKSYGFTDGQWERQKEGIENIVIIKKLTQSISPGPAVLD
FT                   EAVDNIPTLS"
     atgacaacgc tttacataaa aaatttaaga tataatgaag tagcagtctg tcgtgcctta        60
     tttgaagctg ctgaaaagac tgaagaagga ataaagacca agagatatgg catgcaactg       120
     acggctgata tgcctggttt atggtctcct ctttctaatt atgacattga gaatgatctc       180
     agaatggcaa gaattcatcg caatggaaga atgagggaaa ttggatattt gacagttaat       240
     cttgtatttc aatttgatag cctcgatgtt acagagtatg aaacaaaata tggcatttca       300
     gcaaaagacg ttttagaaaa agccggcttt acatgcagtc aagatgcagc gggttattct       360
     gagcctgttt caacttcaac aaggttatta ggccaagaaa gcaaacccga aaaaccaacc       420
     caaacaagtg ttgtaaatac ctcgtttttt tctctaaaga gtgtggatac agataaaaga       480
     tttaccaagt cgacaaaacc aggaatatta tacgaggcaa gatcctacgg taaaatagaa       540
     gatgatactt tgaaaagcta tggttttacc gacggacaat gggaaaggca gaaagaaggc       600
     atcgagaata tagtgattat taaaaaactc acccagagta tttctccagg tccagccgtt       660
     ttggatgaag ctgttgataa tattccaaca ctatcttaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page