(data stored in ACNUC7421 zone)

EMBL: CP000675.PE256

CP000675.PE256       Location/Qualifiers
FT   CDS_pept        269119..270351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54256"
FT                   /protein_id="ABQ54256.1"
FT                   /translation="MNRPVVIVDPLSSGIELAPAFKARGIPAIAVTLKPLDWIGFGANM
FT                   QTSDFIEIIPDQPNLVEVLAKYDPIAIIPGTEEGVPLAEALAITLTPQFANDPEKSQNR
FT                   LHKALMQKALQEAGVPALKTLNTASESEVEAWIRTNGLIDSPLIIKPPVSAGSDKVFHI
FT                   PARGDWKKEFNRVLSEPSKITGKNNETVVVQEQAIGTEFAVGTVSANGKHYLAHLIQYN
FT                   KTSFNDRKTVYNYVEFVPYSQERYGELFEYTQKALDALGVRWGAAHNEIMLTKDGPRLI
FT                   ETGARMCGGPVVGFAREATGSSQADKLVEIYVDGGVSTEEYVFKKTVVPVFLKSPAKGK
FT                   ISNVEAFAELSKLPTFLNEHIWFKNGDLVPQTVDYLTSIGIIGLAGDRKSILLDYEKIR
FT                   NMESKLVIQTF"
     atgaacaggc ccgttgtcat tgtcgatcca ttatcatcag gaatagagtt ggctcctgcc        60
     tttaaggctc gggggatacc tgctattgca gtcacgctta aacctctgga ttggattgga       120
     tttggagcaa acatgcaaac ctcggatttt atcgagatta ttccagacca accaaatctt       180
     gtggaggtac ttgcaaaata cgaccctatt gccattatcc caggcactga ggaaggagtc       240
     cctctcgcgg aagcgttggc gataaccttg acgcctcaat ttgccaatga tcctgaaaaa       300
     tcacagaata gattacacaa ggctctgatg caaaaagcgc tgcaggaagc tggagttcct       360
     gcccttaaga cgctcaatac ggcatctgaa agtgaggttg aagcctggat caggacaaac       420
     ggattaattg attccccact tattattaaa cccccagtat ctgctggcag tgataaggtc       480
     tttcatattc cagccagagg ggattggaaa aaagagttca accgggtttt atcggagcca       540
     tctaaaatta ccgggaaaaa caatgaaacc gtcgttgttc aagagcaggc tataggaaca       600
     gagtttgctg taggtacggt gagtgccaat ggaaaacact atttagcgca tttaatccaa       660
     tataataaaa catcctttaa tgatcgcaaa acggtttaca attatgtgga atttgtgcct       720
     tatagccaag aaagatatgg tgaattattt gagtatacgc aaaaagcatt ggacgcattg       780
     ggagtccgct ggggagctgc tcacaatgaa atcatgctca ctaaagatgg ccctcgtctc       840
     atagaaacag gcgccagaat gtgtggcggc ccagtggttg gctttgctcg agaagcgact       900
     ggcagcagtc aagccgataa actagtggaa atctatgtcg atggaggtgt ttcaacagaa       960
     gaatatgtat ttaaaaaaac ggttgtgcct gtttttttga agtcacccgc taaaggcaaa      1020
     atttcgaatg ttgaagcctt cgccgaacta tcgaaattac cgacttttct taatgaacat      1080
     atttggttta aaaatggtga ccttgttcca caaaccgttg attatttaac gagtattgga      1140
     attattgggt tggctggaga ccgcaagtcc attttattgg attacgaaaa aattcgaaat      1200
     atggagtcga aattggttat ccaaacattt tag                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page