(data stored in ACNUC7421 zone)

EMBL: CP000675.PE258

CP000675.PE258       Location/Qualifiers
FT   CDS_pept        complement(271827..271988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54258"
FT                   /protein_id="ABQ54258.1"
FT                   /translation="MLLTNQSLIQNYYKKRNFIKKITFFGNLDQLDEKAENHSVGYTHS
FT                   LACFFISL"
     atgctattga caaatcagag tctaatacag aattattata aaaaacgaaa ttttattaaa        60
     aaaattactt tctttggtaa tcttgatcag cttgatgaga aagcagaaaa ccattcagtt       120
     ggatatactc attcattggc ttgttttttc atcagcctct aa                          162
//

If you have problems or comments...

PBIL Back to PBIL home page