(data stored in ACNUC7421 zone)

EMBL: CP000675.PE26

CP000675.PE26        Location/Qualifiers
FT   CDS_pept        complement(31047..31619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54026"
FT                   /db_xref="GOA:A5I9H6"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9H6"
FT                   /protein_id="ABQ54026.1"
FT                   /translation="MKRLISCLTIICALNASAAAETTSNPCSRWISFLKPVCQRIHQTW
FT                   AEGHDDMYFSGYAWHNRYVYSNEKIKSYNETAWGGGLGKSLFDEKGNWHGLYAIAFLDS
FT                   HRHFEPAVGYAYLKTASVNKDLKAGLGYSVLVTSRVDYDNVPIPGALPWAALFYKRITI
FT                   AATYIPGSSREGHENGNVLYMLGKISL"
     atgaaaagat taatttcctg cttaaccatt atttgcgctt taaatgcatc cgctgcagcg        60
     gaaacgacat ccaatccttg ttctcgctgg ataagtttcc tcaagcctgt ctgccaacgc       120
     atccaccaaa catgggcaga aggccatgat gatatgtatt tttcaggcta tgcctggcat       180
     aaccgctatg tttacagtaa tgaaaaaatt aagtcctaca atgaaaccgc atggggtggt       240
     ggattaggta aaagtctttt tgatgaaaag ggaaactggc atgggcttta cgccattgcc       300
     ttcctggatt cccatcgcca tttcgagccc gccgttggtt acgcctatct caaaacagct       360
     tcagttaata aagatttaaa agcaggcctt ggatactcgg tattagttac ctctcgggtt       420
     gattatgata atgtccccat ccccggagca ttaccgtggg ctgctctttt ttataaaaga       480
     ataacgatcg cagcaaccta tatacctggg tccagtcgtg aaggacatga gaacgggaat       540
     gtattgtata tgctcggaaa aatatcctta taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page