(data stored in ACNUC7421 zone)

EMBL: CP000675.PE261

CP000675.PE261       Location/Qualifiers
FT   CDS_pept        274273..275265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54261"
FT                   /protein_id="ABQ54261.1"
FT                   /translation="MIVIRGYFYFEINVVYCCANLYVIKHLMYSKYPVFFPNKNIKSFS
FT                   GVRFSNVVGIPSAIESLYRGDNNLADIIFLLPTLITGVFCQNFPEVVDMEQVRLHKLTN
FT                   LSNDFHMVSMSEDPQIALDWGKGCFITIDPVLFSDYIVDVHATFRKNQLNFPDRMEQER
FT                   EHIALAVPFCSIEKITIHNQELANPFYLSIPQDNHEARMEFNTLYSELISLLRKKYTQE
FT                   ADGEEEKVALRAYAIRYLDFYSKFGSCNNPFNKSLAQLVELYPEFMSNFLQSSHLSSKT
FT                   GLMKDVVLNSSENLFKEHPYTQSIDASYIFRVKESTTCYEDDWAKPVYD"
     ttgatcgtaa tacgcggtta tttttatttt gagatcaatg tggtatattg ttgcgcaaat        60
     ttatatgtca ttaaacatct tatgtatagt aaatatccag tatttttccc aaataagaat       120
     ataaagtctt tctcaggtgt gcggttttca aatgttgtag gaattccctc tgccattgaa       180
     tcattatatc gaggtgataa taatcttgct gacataattt ttcttttgcc tactctaatt       240
     acaggagtat tttgtcaaaa ttttcctgag gttgtggata tggagcaagt aagattgcac       300
     aaattaacta acctatctaa tgattttcat atggtgagta tgtcagagga tcctcaaatt       360
     gctctggatt gggggaaagg atgttttatt acaatcgacc ctgttttatt ttctgattat       420
     attgtagatg ttcatgccac ttttcgtaaa aatcagctca attttcctga ccgaatggag       480
     caagaaagag agcatatagc tttagctgtg cctttttgca gcatagaaaa aattacaatt       540
     cacaatcaag aattagctaa ccctttttat ctcagcatac cccaagataa tcatgaagca       600
     agaatggagt ttaatacgct ctacagcgaa ttaatttcac ttttaagaaa aaaatacact       660
     caggaagccg atggggaaga agagaaagtc gcattacgtg cttacgccat acgttattta       720
     gacttttatt ctaaattcgg cagttgtaac aatccattta ataaaagcct tgctcagttg       780
     gttgaactct atccggaatt tatgagcaat tttttgcaat caagtcatct ttcatcaaaa       840
     acaggtttga tgaaagatgt tgtcctgaac tcatcagaaa atttatttaa agaacatcct       900
     tatactcaat cgattgatgc ttcttatatc tttagggtta aagagagcac tacctgttat       960
     gaagatgact gggcaaaacc ggtttatgat tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page