(data stored in ACNUC7421 zone)

EMBL: CP000675.PE265

CP000675.PE265       Location/Qualifiers
FT   CDS_pept        complement(280005..280871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54265"
FT                   /protein_id="ABQ54265.1"
FT                   /translation="MKPGYLLGALLLSPLLAFANSDNNADGLIFSPLPQNKNTVVRHYS
FT                   NEQDMSNLNQMTQRSIDFPTQIVRVSGNLTGLELSCDDVENEIDQIFSKKISPNLFTYN
FT                   TYVSCGFDEHDPEQYATNFSIQSYFDPLTDNAVDYLKNYLKEYNGYNLFNTTTLQIENA
FT                   KGIIVSMNLNAGLKNNPDKTPFMLYRQDRNNFYFKSNFDMRKELITDIYQRFYSNDPDM
FT                   ILPFFDKWIFSYAGSVYYSILKASNYLELQPERIFVMENEGDIFVSDLRYYFANLCMKR
FT                   NPNKHCL"
     atgaaaccag gttatttatt aggcgctttg cttttatctc cccttctcgc tttcgccaat        60
     tctgataaca acgcagatgg ccttattttt tcgccattgc cgcagaataa aaataccgtc       120
     gtaaggcatt atagcaatga acaggacatg tctaatctta accagatgac tcaaagatct       180
     attgattttc caactcaaat tgttcgtgtt agcggaaatc ttacaggatt ggaactgagc       240
     tgtgacgatg tagaaaatga aatagatcaa atcttttcaa aaaaaatttc tcctaatttg       300
     tttacttaca acacctatgt cagctgcggc ttcgatgagc atgatccgga acagtatgcg       360
     acaaatttct ctattcagag ttatttcgat ccattgacag ataacgctgt ggattattta       420
     aaaaactatc tgaaagaata taatggatac aatttattca atactacaac attacaaatt       480
     gaaaatgcca aaggcatcat tgtatcgatg aatcttaatg cgggcttaaa aaacaaccct       540
     gataaaacac cattcatgct ttaccgtcaa gataggaaca atttttattt taaaagcaat       600
     tttgacatga gaaaggaatt aatcaccgat atttatcaac gattttattc taacgatcct       660
     gatatgattc tacccttttt cgacaaatgg attttctcct atgcgggttc agtttattac       720
     tccattctga aggcatccaa ttatcttgaa ttgcaacctg aaagaatctt tgtaatggaa       780
     aatgaagggg atatctttgt ctctgattta agatattatt tcgccaatct ttgtatgaaa       840
     aggaatccta ataaacattg cttgtaa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page