(data stored in ACNUC7421 zone)

EMBL: CP000675.PE269

CP000675.PE269       Location/Qualifiers
FT   CDS_pept        286272..286589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54269"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA69"
FT                   /protein_id="ABQ54269.1"
FT                   /translation="MTMMITTGNSFEGKVIKQYLGIVRGIVVRSPTISQGLMGGLKSIV
FT                   GGKIGAYSQMCEHAREEAFQLMIEHAQALNANGIIAMRYDTGEIGQAGTEVLCYGTAVI
FT                   I"
     atgacaatga tgattacaac aggaaattcg tttgaaggga aagtaattaa acaatatttg        60
     ggtattgtga gaggtatagt agtgcgctct cctaccatca gccagggatt gatgggaggc       120
     ttgaaatcga tcgtcggagg aaaaattggt gcgtactcgc aaatgtgtga gcatgccaga       180
     gaagaagcat ttcagctcat gatagaacat gcccaggcac tcaatgccaa tggcattatt       240
     gccatgcgtt acgatacggg cgaaattggt caggccggca cagaagtttt atgttacgga       300
     acggccgtga ttatttga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page