(data stored in ACNUC7421 zone)

EMBL: CP000675.PE271

CP000675.PE271       Location/Qualifiers
FT   CDS_pept        288157..289146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54271"
FT                   /protein_id="ABQ54271.1"
FT                   /translation="MLPFIFATLLGFIVLMYVILDGFDLGIGILFPFTSSESERDKMMN
FT                   SIAPVWDGNETWLVFGGAMLYGAFPQVYGLLLPILYMPIMLMLIALIFRGVSFEFRYKA
FT                   KRSKTLWNWSFSISSVAATFLQGVILGAFVQGFSINESSMTINDPDWLTPFSLCTGIAL
FT                   VCGYALLGATWMIIKSTGRLQRKMVHYARGLLVLVSFFLLFVSIWTPLHSEEVFHRWYS
FT                   FPNMLLLSPLPLIALIAIYLVWQNLSSGSEYKPFIYSIIIFLCSYIGIAISVYPYLIPH
FT                   HVTLWEAAAPDSTLVFILIGVAIMLPILLAYTLYAYYLFRGKSSENYH"
     atgttaccgt ttattttcgc tacacttctt gggtttatcg ttttgatgta tgtcatttta        60
     gatggttttg atttgggaat tggtatttta tttcctttca cctcaagtga gagcgaacgc       120
     gataaaatga tgaactcgat tgcacctgtt tgggatggca atgaaacctg gctggttttt       180
     ggaggagcca tgctttatgg tgcatttcca caagtttacg gtttgctttt gcccatcctt       240
     tacatgccta tcatgcttat gctgattgca ttgatattcc gtggtgtgag ttttgagttt       300
     cgttataagg ccaagaggtc aaaaactttg tggaattggt cgttttcaat cagttcggtt       360
     gcggccactt ttttgcaagg agttattctt ggcgcttttg tacaggggtt ttctattaat       420
     gaatcttcca tgactatcaa tgatccggac tggcttaccc cttttagcct ttgtaccggt       480
     atcgctttgg tgtgtgggta tgcgcttttg ggggctacct ggatgattat caaaagcacg       540
     ggaagattgc agcgtaaaat ggttcattat gccagaggct tgttagtctt ggtcagcttt       600
     ttcctgcttt tcgttagtat ttggacacct ttgcatagtg aggaagtgtt tcatcgttgg       660
     tatagttttc cgaatatgct actactgagc cccttgccct tgatagcctt aatagctatt       720
     tacctcgtat ggcagaactt aagttccggc agtgaataca aaccgtttat ttacagtatc       780
     attatatttt tatgctccta tataggaatt gcaatcagtg tctaccctta cctgattcct       840
     catcacgtga ctctttggga ggcggcagca cctgattcca cacttgtttt tatcttgata       900
     ggtgtcgcta tcatgctgcc aatccttctt gcctataccc tttatgctta ttaccttttt       960
     cggggtaaat catcagaaaa ttatcactag                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page