(data stored in ACNUC7421 zone)

EMBL: CP000675.PE272

CP000675.PE272       Location/Qualifiers
FT   CDS_pept        complement(289147..289923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54272"
FT                   /protein_id="ABQ54272.1"
FT                   /translation="MIILLVIAIIFLHMCLIWLWYRYTNNPSVVDVGWASGLTLAGLIY
FT                   LNNQEFSLRSLLLVLALLTWGIRLGGYLWWTRIRLKKIDKRYLALSNDWKLAKPLGFFL
FT                   NFQLQGVLICLVSIPWYFSSSETQTTLNLLDGLALMIFLTALILETVADNQLQDFKKNY
FT                   PGKVCNQKLWRYCRHPNYFYEWLVWCSFTLFALSAPYGWIAIISPLTLYLIMTKITAPM
FT                   TEQGSIESRGNLYIEYQKVTPMFFPKWLKNNSTPRK"
     atgataattt tactcgtgat cgccatcatc tttttacata tgtgcttgat ttggctatgg        60
     taccgttaca ccaataatcc ttccgttgtt gatgtgggat gggcctctgg tttaacactc       120
     gccggactta tttatttaaa taatcaagaa ttttcattgc gctctttact gctcgtcttg       180
     gcattgctta cctggggaat caggcttgga gggtatttat ggtggacacg aatacgcctt       240
     aaaaaaatag acaagcgcta tcttgcttta agcaatgatt ggaagcttgc caaacctttg       300
     ggattttttt taaattttca gttgcaaggc gtattgattt gccttgtttc cattccctgg       360
     tatttttctt cctcagaaac tcaaacaaca ctaaatctat tggatgggct cgcattgatg       420
     atatttctca cggccttaat tttggaaaca gttgccgaca accaattgca agattttaag       480
     aaaaactatc ctggaaaagt ctgcaatcaa aagctttggc gttactgcag gcatccaaat       540
     tatttttatg aatggctggt atggtgctcc tttaccttat ttgccctttc cgctccttat       600
     ggatggatag ccattatttc tccattgacc ctttatttaa tcatgacaaa aatcacagct       660
     cccatgactg aacaaggctc gattgaatcc agaggcaatc tttacataga gtatcaaaaa       720
     gtgaccccca tgtttttccc taaatggctt aaaaataatt cgacgcccag aaaataa          777
//

If you have problems or comments...

PBIL Back to PBIL home page