(data stored in ACNUC7421 zone)

EMBL: CP000675.PE273

CP000675.PE273       Location/Qualifiers
FT   CDS_pept        complement(289929..290465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54273"
FT                   /protein_id="ABQ54273.1"
FT                   /translation="MIINPVHTVHYLSYYLCWIFCIYLASYGYPLLGLIITVLIMGLQI
FT                   IVQILNQLPWRDALYFSIGLTLLGAITDAIWLYTGMIYFKANFFGSHFPPLWMVALWLS
FT                   FGFNLVVLYGSWLTHYFLWGLVMFPSIIFAYWLGVQFGAATLIGSEVVFYLTLGLTWSL
FT                   FLPLSLYLFNYQHRK"
     atgattatta atcctgtgca tacagttcat tatctgtcgt actatctgtg ctggatattt        60
     tgtatctacc tagcctctta tggctatcct ttgctgggat taatcattac cgtattaatc       120
     atgggcctac agattattgt gcagatactt aatcaactcc cctggcgtga tgccctctat       180
     ttttccattg gactaacctt gttaggtgcg atcactgatg ccatctggct ttataccggt       240
     atgatctatt ttaaggccaa tttctttgga tctcattttc ctccgctttg gatggtcgct       300
     ctctggctaa gtttcggatt taatctcgtt gttttatatg gttcctggtt aactcactat       360
     tttctttggg ggttagtcat gtttccctct attatctttg cctattggct aggggtacaa       420
     tttggagcag caacccttat cggcagtgaa gttgtatttt accttacttt agggttaacc       480
     tggtctctat tcttgccttt gagtttatac ttatttaatt accagcatag gaaatga          537
//

If you have problems or comments...

PBIL Back to PBIL home page