(data stored in ACNUC7421 zone)

EMBL: CP000675.PE276

CP000675.PE276       Location/Qualifiers
FT   CDS_pept        293040..294542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54276"
FT                   /protein_id="ABQ54276.1"
FT                   /translation="MTTLCFILGDQLNETIASLAAINKQKDIVFLCEVAEETSYVPHHP
FT                   KKIAFLFSAMRHFAQQLKKKGYRVRYTAFDDPRNQGSFAKELLRAIEEEQVSAISLTEP
FT                   GEWRVLKIFHDLKSQLTIPVTLHEDNRFLCKINEFRNWAKEKKQLRMEFFYRMMRQKYH
FT                   LLVDNDGKPVGGSWNYDAQNRKNANRISSFPKRLEHARDVITDEVLGLVSAHFAKHFGQ
FT                   CYPFNLAVTREQALEEADYFMEHFLCNFGAYQDAMLKDEISLYHSKLSSYLNAGLLLPL
FT                   ELCQMAEQAYFSKQMPLNSVEGFIRQILGWREYVRGIYWLFMPDYGEMNYFNACRPLPS
FT                   FFWGEETGMFCIKEVVRQTSNEAYSHHIQRLMITGNFALLAGLDPKQVCEWYLAVYADA
FT                   YEWVELPNTLGMALYADGGLMASKPYAASGKYIHRMSNFCQSCYYNPNDLLGEKACPFN
FT                   ALYWNFLHQNQEKLKDNPRLHYAYMNWQKMDFDKQKKTIHKA"
     atgacgacac tgtgttttat attaggcgat caactcaatg aaacaatcgc ttcacttgcg        60
     gcaattaata aacagaagga cattgtattt ttatgtgaag tggcagaaga aacttcttat       120
     gtccctcatc atccgaaaaa aatcgcgttc ttattttcgg caatgcgtca ttttgcgcaa       180
     caattgaaaa agaaaggtta tcgagtccgc tatacggcat tcgatgatcc tcgcaatcaa       240
     ggcagttttg ccaaagaatt gcttcgtgcc attgaagagg agcaggtgtc agcaataagc       300
     cttaccgaac ctggagagtg gcgtgttctg aaaatattcc atgatttaaa aagccaattg       360
     actattcctg tcactctaca tgaagacaat cggtttttat gcaaaattaa tgagttcaga       420
     aattgggcta aggaaaaaaa acagctacgg atggagtttt tttaccggat gatgcgccaa       480
     aaatatcatc ttctggtcga taatgatggg aaaccagttg gcggctcatg gaattatgat       540
     gcccaaaatc gtaaaaatgc caatcgcatc agttcattcc ccaagcgttt agagcatgcc       600
     agggatgtga taactgatga ggttttgggc ttggtttcag cgcattttgc caagcacttt       660
     ggtcagtgct atccctttaa tttggcagtg acccgcgagc aagcattaga agaagccgat       720
     tattttatgg aacattttct ttgcaatttt ggtgcgtatc aggatgccat gctcaaagat       780
     gaaatcagct tatatcattc aaaactgtcg tcttatctaa atgctgggct tttattgcct       840
     ctggaattgt gtcaaatggc agagcaagcc tatttctcaa agcaaatgcc tcttaactcg       900
     gtagaaggat tcatacgcca aattttagga tggcgagaat atgtgagggg tatttattgg       960
     ctttttatgc cggattacgg cgagatgaac tattttaatg catgcagacc gttgccttcc      1020
     tttttttggg gagaggaaac gggaatgttt tgtattaagg aagtggtacg tcagacctcg      1080
     aatgaagcct attcccacca tattcagcgg ttgatgataa caggtaattt tgccttgctt      1140
     gcaggtttag atcccaaaca agtttgtgag tggtatcttg ctgtctatgc tgatgcgtat      1200
     gaatgggtag agttacccaa tacattgggt atggctcttt atgcagatgg ggggctgatg      1260
     gccagtaaac cgtatgccgc cagtgggaaa tacattcacc gcatgagtaa tttttgccaa      1320
     tcctgctatt ataatcccaa tgatcttttg ggtgaaaagg catgtccttt taatgcgctc      1380
     tattggaatt ttcttcacca aaatcaagaa aaattaaaag ataaccctcg ccttcattat      1440
     gcctatatga attggcaaaa aatggatttt gataaacaaa agaaaactat ccataaagca      1500
     taa                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page