(data stored in ACNUC7421 zone)

EMBL: CP000675.PE277

CP000675.PE277       Location/Qualifiers
FT   CDS_pept        complement(294583..294996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0282"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54277"
FT                   /protein_id="ABQ54277.1"
FT                   /translation="MNGWTLKVFAIALFIFIVTDMIWLGFIARNLYFDQYQQWLRLSEG
FT                   QLKPIWWSALLVYLLFALSIVVFVIPLAKTSLPYAALYGALLGAIIYGIYDFTCLAIFK
FT                   DFPVGMAFLDWLWGIVLCSWSSIATIYVAGYIK"
     atgaatggat ggacgcttaa ggtttttgcg attgccttgt ttatctttat tgtgacagat        60
     atgatatggc ttgggttcat cgccagaaat ctttattttg accaatacca acagtggctg       120
     cgtctttcag aggggcaatt aaagccaata tggtggtccg ctttattagt ttatctgctt       180
     tttgccttga gtattgttgt ctttgttata ccgctggcta aaacatcgct accttatgcc       240
     gcattatatg gcgcgcttct tggtgctatt atttatggaa tttatgattt tacctgcctc       300
     gctattttta aggattttcc agtcggtatg gcattccttg attggctatg gggtatagta       360
     ctgtgctcct ggagttcgat agcgactatc tatgtggcag gttatatcaa ataa             414
//

If you have problems or comments...

PBIL Back to PBIL home page