(data stored in ACNUC7421 zone)

EMBL: CP000675.PE279

CP000675.PE279       Location/Qualifiers
FT   CDS_pept        298275..300245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54279"
FT                   /protein_id="ABQ54279.1"
FT                   /translation="MLSKEKINPSLKNTKRQGSDNLAAMADPTSLKNTSDYRCFNSKPE
FT                   AYTYFIFLLNQWQTNYMADKREAIAKAIDSIKMAYENHEQDTLVVHKTLHGLSHLLEQE
FT                   HADELNALCLVPIKDSQSNANNILPRRFESELACRLIESPTKSMMEAIDLVSQAIINLI
FT                   EEYSKLDSKSSERAALNFFLQELEGSDIEFGAFKKRPTLEEVIAILKENNPKNFIQIQF
FT                   ISFMFARNVIGPFPLRNLPPFKPTGLFAQVLDKYLQDHPDLKEEEEGFSYQLMAAKNEA
FT                   EEFRTFITKKLFYQDELYTQGENRGRQGPRKTYLKTNQLGLMKLDHSAHSRGLTVIPEQ
FT                   TWCADAQAQEANQNSIYYKTALTNDCLYVTGPSGMTSIYMNMMLLLLNPQNIELIQAYS
FT                   LGIIAYIVGAGFHSVNEILIPLVKCINLLPNYPSYEGLEYLTHPPLYHEYFKQIAQFDS
FT                   DFIQLRDQVWIHYLNYFKSCYMPLCMRDFCEAEQLANCPDAAPEVKILCSIVLKSIEDC
FT                   INFHNLNRHLDSRFLGTTTADIDALNQLKEACASQSSISGIMRLLQKYFSGENIARPTA
FT                   MHKFETRSYIRFFLDALKDNPQIISHINEKMKLDPPLTISTKAEIFSDDFRIECFNVHR
FT                   ILKREHQVSEDCNNTSQFLKL"
     atgttaagta aagaaaaaat taacccttct ctaaaaaata caaaacgcca aggcagcgat        60
     aaccttgctg ccatggctga cccgacatca ttaaaaaaca cgagtgacta ccgatgtttt       120
     aattcaaaac cagaggctta cacttatttt atttttttat taaatcaatg gcagaccaat       180
     tacatggccg acaaaagaga agcgatagct aaagccattg attcaataaa aatggcttat       240
     gaaaatcatg agcaagatac tttggtcgtt cacaaaacgt tacatggctt gagtcacttg       300
     cttgagcagg agcatgccga tgagttaaat gcgttatgct tggtgcctat caaagacagt       360
     caatctaatg caaacaatat tctgccccgg agatttgaat cagagctggc ttgccgcttg       420
     atagaatcgc caacaaaaag catgatggaa gcaattgatc tggtatctca agctataatc       480
     aatttaatcg aagagtatag taaattagac tcgaaatctt ccgaacgagc tgcgctgaat       540
     ttttttctgc aagagttaga gggttctgat atagagtttg gggcttttaa aaaaaggcca       600
     actctggaag aggttattgc tattttaaag gaaaataatc cgaagaattt tattcaaatt       660
     caattcatat cctttatgtt tgctcgcaat gtaatcggac catttccatt acgaaatttg       720
     ccaccattta agccaactgg cctttttgcc caagttctgg ataaatattt acaggatcat       780
     cccgacttga aagaagaaga ggaaggcttt tcctatcagc ttatggcagc caaaaatgaa       840
     gcagaagaat ttagaacttt catcactaaa aaattatttt accaggatga gctttatacc       900
     caaggagaaa atagagggcg tcaaggacct cgtaaaacct acttaaaaac caaccagtta       960
     ggattgatga agctggatca ttcagcgcat agcagggggt taaccgttat tcctgaacaa      1020
     acttggtgtg cggatgctca agcacaagaa gctaatcaga attcgatata ttacaagact      1080
     gcacttacaa atgattgtct ctatgtcact ggcccttctg gcatgacttc tatctatatg      1140
     aacatgatgc tgctgctttt aaatcctcaa aatatcgaat taatacaagc ctacagcctt      1200
     ggaattatag catatatcgt cggtgccggt tttcacagtg tcaacgaaat tcttattccc      1260
     ctggtgaaat gcattaatct tctgcctaat tatccaagct acgagggact tgaatattta      1320
     actcatcctc ctctttatca tgaatacttt aagcaaattg cacaatttga ctctgatttt      1380
     attcagttaa gagatcaagt atggatacac tatctaaatt attttaaatc gtgctatatg      1440
     cccttatgta tgagagattt ctgcgaggct gaacagcttg caaattgtcc tgacgccgct      1500
     cctgaagtaa aaatattatg cagtattgtg cttaaatcaa ttgaggactg cattaatttt      1560
     cataatctta ataggcatct ggacagcagg tttttaggta cgactactgc ggacatcgat      1620
     gctcttaatc aattgaagga ggcttgcgcg agtcaatcct ccattagcgg tattatgcga      1680
     ttattgcaaa aatatttttc aggggaaaat attgcccggc caacagcgat gcataaattt      1740
     gaaactcgtt cttatatccg ttttttcctt gatgctttaa aagataaccc gcaaatcata      1800
     tctcatatca atgagaaaat gaaattggat cctccattaa caatcagtac aaaggctgaa      1860
     attttttcag atgattttcg aatagagtgc tttaatgtgc atcgaattct aaaaagagaa      1920
     caccaggtga gtgaagattg taacaacact agccagtttt taaagttgta a               1971
//

If you have problems or comments...

PBIL Back to PBIL home page