(data stored in ACNUC7421 zone)

EMBL: CP000675.PE283

CP000675.PE283       Location/Qualifiers
FT   CDS_pept        complement(302590..303297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0288"
FT                   /product="inner membrane protein, LrgB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54283"
FT                   /protein_id="ABQ54283.1"
FT                   /translation="MPSSILSESMIQAFFWSLITIGMYFITQKLYRRWPFWWLMPLALT
FT                   PILVASIVLLLHVNYQDYFRGTKWLVLLIGPATVAFAIPIYEKRALIRQHWPVLLIGVI
FT                   VGSFTAIASSWGLAILLGLDDNLRLSLLPRSISTPFAIEISRGIGAAPDLTAIFVIVTG
FT                   ILGAILGEFILSRLPFNSALARGALLGVGAHAAGTAQAHKIGNTEGAIASLAMILVGLF
FT                   NILLLPLISYLLK"
     atgccaagca gcattctctc tgaatccatg atccaggcat ttttctggtc gcttatcaca        60
     ataggcatgt attttattac ccaaaagcta tatagaagat ggcccttttg gtggctaatg       120
     ccgcttgctt taacaccaat actggttgcc agcatagtgc ttttattgca tgtaaactac       180
     caggactatt tccgcggaac aaaatggcta gtcttgttaa tcggtcctgc aaccgtggcc       240
     tttgccattc ccatttatga aaaacgtgcc ctcattcgcc agcattggcc agtactttta       300
     attggcgtga ttgtgggaag tttcactgcc atagcatcca gttggggatt ggcaatcctt       360
     cttggccttg atgataattt acgtttaagt ctgctccccc gctctatcag cacaccgttt       420
     gctatagaaa tctcaagggg aattggtgca gcacctgatt tgactgcgat ttttgttatt       480
     gtcacaggga tattgggagc tatcctcggt gagttcatcc tgtcgcgctt gccttttaac       540
     tcagctcttg ccagaggtgc ccttttagga gtaggagccc atgcggcagg aaccgctcag       600
     gcccataaaa tagggaatac ggaaggcgcc attgccagtt tggctatgat tttagtaggt       660
     ctattcaata tacttcttct cccccttatc agctatcttt tgaaataa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page