(data stored in ACNUC7421 zone)

EMBL: CP000675.PE286

CP000675.PE286       Location/Qualifiers
FT   CDS_pept        304641..304751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54286"
FT                   /protein_id="ABQ54286.1"
FT                   /translation="MLIISFRLGNARDLFSYCPKEAGVLKIIAAVAILHI"
     atgttgataa ttagttttag attggggaat gcaagagatt tattttccta ttgtccaaaa        60
     gaggcaggtg tattgaaaat cattgctgct gtagccatac ttcatatcta a                111
//

If you have problems or comments...

PBIL Back to PBIL home page