(data stored in ACNUC7421 zone)

EMBL: CP000675.PE287

CP000675.PE287       Location/Qualifiers
FT   CDS_pept        304776..304988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0292"
FT                   /product="conserved hypothetical protein; DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54287"
FT                   /db_xref="GOA:A5IA87"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA87"
FT                   /protein_id="ABQ54287.1"
FT                   /translation="MNNQKKIKCPICGKQNTWRPDNQFRPFCSERCKLIDLGEWASESR
FT                   KIPGSSIDPESIVTTNNKQDNVDEQ"
     atgaacaacc agaaaaaaat caaatgcccc atttgcggca agcaaaatac ctggcgccct        60
     gataaccagt tcaggccttt ttgctctgag cgatgcaagt taatcgattt gggagaatgg       120
     gccagcgaaa gccgaaaaat tcctggaagc tccattgatc ctgagtctat agtgacaacc       180
     aataataagc aggataatgt agatgagcag tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page