(data stored in ACNUC7421 zone)

EMBL: CP000675.PE29

CP000675.PE29        Location/Qualifiers
FT   CDS_pept        complement(34192..34833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0029"
FT                   /product="ubiquinone biosynthesis protein COQ7"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54029"
FT                   /db_xref="GOA:A5I9H9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9H9"
FT                   /protein_id="ABQ54029.1"
FT                   /translation="MRTSSFLDRLIGEVDSALRTLVLPQKRITTRQSPAENLADTVLSA
FT                   QEKKHISGLMRVNHAGEVCAQALYQGQALTARLTHIKEQMASAAAEEVDHLAWCEERLY
FT                   ELGSKPSLLNPIWYCGSVLLGALAGLAGDKISLGFVAETERQVTAHLQRHLHYLPEKDK
FT                   KTIAILKRMQEDEEHHAHTAMEAGAVELPYIIKQLMNAVSKLMTQSSYYI"
     atgcgaacat caagcttcct cgatagatta ataggtgaag tcgatagtgc gcttcgaacc        60
     ctcgttttgc cacaaaaacg tattacaacg cgccaatctc ccgctgaaaa cctggctgat       120
     actgtgcttt ctgctcagga aaaaaaacat atttcaggat taatgagagt aaatcatgcc       180
     ggagaagtat gtgctcaagc gctttatcaa ggacaagctt taacagcacg actcactcac       240
     atcaaagagc aaatggctag tgccgcggct gaagaagttg atcatttggc ctggtgcgaa       300
     gaacgtttgt atgaattagg cagcaaaccc agccttttaa atcccatctg gtattgtggt       360
     tcggttctat taggcgccct ggctggattg gctggcgata aaatcagctt gggattcgtt       420
     gctgaaacag agcgccaggt aaccgctcat ttacaaagac atctgcatta tctcccggaa       480
     aaggataaaa aaactatagc catattaaaa agaatgcaag aagacgagga acatcatgcg       540
     catacagcca tggaagctgg agcagttgaa cttccctata ttattaagca attgatgaat       600
     gctgtatcaa aattaatgac tcagagcagt tattatattt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page